Protein Information |
Information Type | Description |
---|---|
Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
NCBI Accession ID | CP001114.1 |
Organism | Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) |
Left | 621064 |
Right | 621354 |
Strand | + |
Nucleotide Sequence | ATGATTGACGCGGCCCAGTTGGACCACCTCGCGCAGCTTGCGCGGCTGCACCTCAAACCAGAAGAGCGCGAGGCGATGACCGCCGACCTGAACAGCATCCTGGGATACTTCGAACAACTTCGGGAAGTGAATACTGACGGCGTTGAGGAGATGCAGCGTCCGGTGAACCTGGTGAATGTCCTGCGTGACGACGTGCCCGGTGAGGTGTTTGCGCCGGAAGTGGTCGAGGCCCTGGCACCTGAGATGCATGGCGGGCAGATTCGCGTGCCGCGCACAGTCGAGGCCGACTGA |
Sequence | MIDAAQLDHLAQLARLHLKPEEREAMTADLNSILGYFEQLREVNTDGVEEMQRPVNLVNVLRDDVPGEVFAPEVVEALAPEMHGGQIRVPRTVEAD |
Source of smORF | Swiss-Prot |
Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
Pubmed ID | 19370165 |
Domain | CDD:412411 |
Functional Category | Others |
Uniprot ID | C1D0J7 |
ORF Length (Amino Acid) | 96 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 621064 | 621354 | + | NC_012526.1 | Deinococcus deserti VCD115 |
2 | 999906 | 1000196 | + | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
3 | 1381844 | 1382134 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
4 | 1469151 | 1469441 | + | NZ_CP010028.1 | Deinococcus radiopugnans |
5 | 1240009 | 1240299 | + | NZ_CP011387.1 | Deinococcus puniceus |
6 | 2854504 | 2854797 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
7 | 574290 | 574580 | - | NZ_CP021081.1 | Deinococcus ficus |
8 | 2273271 | 2273564 | + | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
9 | 485685 | 485975 | + | NZ_CP031500.1 | Deinococcus radiodurans |
10 | 2704926 | 2705213 | + | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
11 | 2163404 | 2163694 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
12 | 3261841 | 3262143 | - | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
13 | 501092 | 501331 | - | NC_015161.1 | Deinococcus proteolyticus MRP |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02403.24 | 1.0 | 13 | 33 | same-strand | Seryl-tRNA synthetase N-terminal domain |
2 | PF00587.27 | 1.0 | 13 | 33 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |