Result : C1CXK0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | CP001114.1 |
| Organism | Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) |
| Left | 11416 |
| Right | 11694 |
| Strand | - |
| Nucleotide Sequence | ATGACCCAGCAAAGCAACAGCGCGGACCGCAAGCCGCGCGGTAAGGGACCCAAGCGTCCCCGCAAGCCGAAGGTTGACCCATTCTCCATTGGAGAATTGGAAATCACCGATTACAAAGACGTGAAAATGCTCCGCCGCTTCGTCAGCGACACGGGCAAGATCCTTCCCCGCCGCCGCACGGGCCTCTCGGCCAAGCACCAGCGCCGCATCGCGCAGACCATTAAGGTCGCGCGCCAGCTCGCTCTGTTGCCCTACACCGAGAAGCTCGTCCGGAAATAA |
| Sequence | MTQQSNSADRKPRGKGPKRPRKPKVDPFSIGELEITDYKDVKMLRRFVSDTGKILPRRRTGLSAKHQRRIAQTIKVARQLALLPYTEKLVRK |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | 19370165 |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C1CXK0 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 62
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 11416 | 11694 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 2 | 1947131 | 1947409 | + | NZ_CP031500.1 | Deinococcus radiodurans |
| 3 | 532463 | 532735 | - | NZ_CP011387.1 | Deinococcus puniceus |
| 4 | 1834499 | 1834774 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 5 | 13709 | 13984 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 6 | 133442 | 133717 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
| 7 | 152907 | 153182 | - | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 8 | 12850 | 13125 | - | NZ_CP021081.1 | Deinococcus ficus |
| 9 | 3286509 | 3286778 | + | NZ_CP010028.1 | Deinococcus radiopugnans |
| 10 | 97073 | 97339 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 11 | 405383 | 405649 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 12 | 611903 | 612169 | + | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 13 | 2000144 | 2000407 | + | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 14 | 87201 | 87455 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 15 | 822696 | 822923 | + | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 16 | 2018228 | 2018494 | + | NZ_CP038452.1 | Thermus caldilimi |
| 17 | 235199 | 235465 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 18 | 21153 | 21419 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 19 | 1989184 | 1989453 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 20 | 100070 | 100339 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 21 | 870570 | 870839 | - | NZ_CP016312.1 | Thermus brockianus |
| 22 | 3292272 | 3292502 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 23 | 3541208 | 3541435 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 24 | 2001509 | 2001760 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 25 | 2686490 | 2686717 | - | NZ_CP034118.1 | Staphylospora marina |
| 26 | 254177 | 254404 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 27 | 3611401 | 3611628 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 28 | 3320085 | 3320312 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 29 | 8083903 | 8084196 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 30 | 1125158 | 1125433 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 31 | 2805029 | 2805283 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 32 | 7044098 | 7044370 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 33 | 2091572 | 2091832 | + | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 34 | 2253921 | 2254202 | + | NZ_CP047045.1 | Terricaulis silvestris |
| 35 | 945769 | 945999 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 36 | 2570953 | 2571183 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 37 | 599462 | 599692 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 38 | 1075767 | 1075997 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 39 | 90184 | 90447 | - | NZ_LN606600.1 | Acetobacter senegalensis |
| 40 | 65010 | 65303 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 41 | 90250 | 90540 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 42 | 2256169 | 2256450 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 43 | 132171 | 132464 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 44 | 1234332 | 1234586 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 45 | 2485902 | 2486159 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 46 | 1415786 | 1416055 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 47 | 194241 | 194480 | + | NZ_CP014176.1 | Clostridium argentinense |
| 48 | 2469539 | 2469808 | - | NZ_CP012401.1 | Azospirillum thiophilum |
| 49 | 1374186 | 1374425 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 50 | 220307 | 220564 | - | NZ_CP043043.1 | Gluconobacter thailandicus |
| 51 | 238222 | 238479 | - | NZ_CP032485.1 | Neokomagataea tanensis |
| 52 | 2222753 | 2223034 | - | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 53 | 1260438 | 1260668 | + | NZ_CP062147.1 | Komagataeibacter hansenii |
| 54 | 1686398 | 1686649 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 55 | 1996775 | 1997044 | + | NZ_CP054619.1 | Azospirillum oryzae |
| 56 | 3074961 | 3075272 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 57 | 964158 | 964433 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 58 | 1466335 | 1466562 | - | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 59 | 1792536 | 1792763 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 60 | 2894008 | 2894268 | - | NZ_CP044117.1 | Roseomonas mucosa |
| 61 | 1750568 | 1750822 | + | NC_014313.1 | Hyphomicrobium denitrificans ATCC 51888 |
| 62 | 89387 | 89614 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 63 | 2067210 | 2067455 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012526.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03948.16 | 0.81 | 50 | 12.0 | same-strand | Ribosomal protein L9, C-terminal domain |
| 2 | PF01281.21 | 0.81 | 50 | 12.0 | same-strand | Ribosomal protein L9, N-terminal domain |
| 3 | PF00436.27 | 0.65 | 40 | 34.5 | same-strand | Single-strand binding protein family |
| 4 | PF01250.19 | 0.97 | 60 | 556.5 | same-strand | Ribosomal protein S6 |
++ More..