ProsmORF-pred
Result : C1CP08
Protein Information
Information Type Description
Protein name DNA-directed RNA polymerase subunit epsilon (RNAP epsilon subunit) (EC 2.7.7.6) (RNA polymerase epsilon subunit) (Transcriptase subunit epsilon)
NCBI Accession ID CP000921.1
Organism Streptococcus pneumoniae (strain Taiwan19F-14)
Left 153480
Right 153713
Strand -
Nucleotide Sequence ATGATTTACAAAGTTTTTTATCAAGAAACAAAAGAACGTAGCCCACGCCGTGAAACAACACGCACGCTTTACCTAGACATCGATGCCAGCTCAGAACTTGAGGGCCGTATCACTGCTCGCCAACTTGTCGAAGAAAATCGCCCAGAGTACAATATCGAGTATATCGAACTCTTGTCTGACAAATTGCTCGATTACGAAAAAGAAACTGGCGCCTTCGAAATTACGGAGTTCTAA
Sequence MIYKVFYQETKERSPRRETTRTLYLDIDASSELEGRITARQLVEENRPEYNIEYIELLSDKLLDYEKETGAFEITEF
Source of smORF Swiss-Prot
Function A non-essential component of RNA polymerase (RNAP). {ECO:0000255|HAMAP-Rule:MF_01553}.
Pubmed ID 21034474
Domain CDD:416298
Functional Category Others
Uniprot ID C1CP08
ORF Length (Amino Acid) 77
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 73
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1912298 1912531 - NZ_CP032621.1 Streptococcus gwangjuense
2 209081 209314 - NC_015875.1 Streptococcus pseudopneumoniae IS7493
3 1810208 1810441 + NZ_LR134336.1 Streptococcus oralis ATCC 35037
4 1739376 1739606 + NZ_CP065061.1 Streptococcus equi subsp. zooepidemicus
5 254024 254254 + NZ_CP043405.1 Streptococcus ratti
6 1701679 1701909 + NC_017581.1 Streptococcus thermophilus JIM 8232
7 1700306 1700536 + NZ_LR134512.1 Streptococcus agalactiae
8 822432 822662 - NZ_CP032620.1 Streptococcus koreensis
9 241554 241784 - NZ_LS483383.1 Streptococcus cristatus ATCC 51100
10 1745392 1745622 + NZ_AP014612.1 Streptococcus troglodytae
11 1869428 1869658 + NZ_LR594046.1 Streptococcus dysgalactiae
12 1269155 1269385 + NZ_CP013237.1 Streptococcus mutans
13 847951 848181 - NZ_LR134293.1 Streptococcus canis
14 236799 237029 - NZ_LR594049.1 Streptococcus gordonii
15 1804567 1804797 + NZ_CP025536.1 Streptococcus pluranimalium
16 1730617 1730847 + NZ_LR134275.1 Streptococcus vestibularis
17 1492961 1493191 + NZ_CP010450.1 Streptococcus pyogenes
18 150333 150563 - NC_012924.1 Streptococcus suis SC84
19 1463509 1463739 - NZ_LR134341.1 Streptococcus pseudoporcinus
20 527466 527696 + NZ_CP054015.1 Streptococcus gallolyticus
21 169292 169522 - NZ_AP018400.1 Streptococcus ruminantium
22 1736824 1737054 + NZ_LR594050.1 Streptococcus porcinus
23 284937 285167 - NZ_CP029491.1 Streptococcus sobrinus
24 1555439 1555669 + NZ_LS483403.1 Streptococcus lutetiensis
25 1918387 1918617 + NZ_CP039457.1 Streptococcus pasteurianus
26 386048 386278 + NZ_CP016953.1 Streptococcus himalayensis
27 1873458 1873688 - NZ_CP014835.1 Streptococcus halotolerans
28 1719938 1720168 + NZ_CP012805.1 Streptococcus anginosus
29 1653799 1654029 + NZ_CP034543.1 Streptococcus periodonticum
30 191677 191907 - NZ_LS483436.1 Streptococcus intermedius
31 1854152 1854382 + NZ_CP014699.1 Streptococcus pantholopis
32 355404 355634 - NZ_CP031733.1 Streptococcus chenjunshii
33 906301 906531 - NZ_CP015196.1 Streptococcus marmotae
34 562446 562676 - NZ_CP022680.1 Streptococcus respiraculi
35 1610072 1610302 + NZ_LS483343.1 Streptococcus ferus
36 2222594 2222824 - NZ_LT906439.1 Streptococcus merionis
37 479646 479876 - NZ_CP070872.1 Lactococcus taiwanensis
38 2451163 2451393 - NZ_CP032627.1 Lactococcus allomyrinae
39 285383 285613 - NC_022369.1 Lactococcus lactis subsp. cremoris KW2
40 574352 574582 - NZ_CP065637.1 Lactococcus garvieae
41 230334 230546 + NZ_CP027783.1 Tetragenococcus osmophilus
42 689409 689621 - NZ_CP012047.1 Tetragenococcus halophilus
43 675376 675588 - NZ_LS483306.1 Enterococcus cecorum
44 795544 795759 - NZ_CP049886.1 Vagococcus coleopterorum
45 739371 739583 - NZ_CP047141.1 Ligilactobacillus animalis
46 577714 577926 - NZ_CP018061.1 Enterococcus mundtii
47 1348096 1348308 + NZ_AP014680.1 Paucilactobacillus hokkaidonensis JCM 18461
48 1683763 1683975 + NZ_CP065993.1 Leuconostoc pseudomesenteroides
49 1504572 1504784 - NC_014136.1 Leuconostoc kimchii IMSNU 11154
50 2035106 2035318 + NC_020207.1 Enterococcus faecium ATCC 8459 = NRRL B-2354
51 2095969 2096181 + NZ_CP065211.1 Enterococcus lactis
52 3427834 3428046 - NZ_CP021874.1 Enterococcus wangshanyuanii
53 1587499 1587717 + NZ_CP030105.1 Lactiplantibacillus plantarum
54 692749 692961 - NZ_AP022822.1 Enterococcus saigonensis
55 2191971 2192189 + NZ_CP032757.1 Lactiplantibacillus pentosus
56 1301125 1301337 - NZ_CP023011.2 Enterococcus hirae
57 1987018 1987230 + NZ_CP023074.1 Enterococcus thailandicus
58 1588628 1588840 + NZ_CP015247.1 Leuconostoc suionicum
59 87083 87295 - NZ_CP028251.1 Leuconostoc mesenteroides
60 601325 601537 + NZ_CP042374.1 Leuconostoc carnosum
61 1245703 1245915 - NZ_LS991421.1 Lacticaseibacillus zeae
62 1252753 1252965 - NC_014334.2 Lacticaseibacillus paracasei
63 1200193 1200405 - NZ_AP012544.1 Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393
64 501166 501378 - NC_018631.1 Leuconostoc gelidum JB7
65 846840 847064 - NZ_CP029544.1 Lactobacillus helsingborgensis
66 1181782 1181994 + NZ_LN898144.1 Paucilactobacillus oligofermentans DSM 15707 = LMG 22743
67 914543 914767 - NZ_CP029477.1 Lactobacillus kullabergensis
68 718973 719197 - NZ_CP029476.1 Lactobacillus apis
69 865424 865663 - NZ_CP017326.1 Weissella soli
70 790812 791033 + NZ_CP031835.1 Lactobacillus amylolyticus
71 812831 813052 - NC_021181.2 Lactobacillus acidophilus La-14
72 498199 498414 + NZ_CP049887.1 Vagococcus hydrophili
73 360867 361082 - NZ_CP034726.1 Acetilactobacillus jinshanensis
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP032621.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF17770.3 0.97 71 3 same-strand Ribonuclease J C-terminal domain
2 PF07521.14 0.74 54 3.5 same-strand Zn-dependent metallo-hydrolase RNA specificity domain
++ More..