Result : C1AMA1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AP010918.1 |
| Organism | Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) |
| Left | 1236719 |
| Right | 1236976 |
| Strand | - |
| Nucleotide Sequence | ATGGTCTGTGACCCCAACGGCGATGACACGGGCAGAACCCACGCAACTGTGCCTGTCAGTCAGCTTGGCTATGAAGCCTGCCGGGACGAGCTGATGGAAGTCGTGCGGCTTCTGGAGCAGGGCGGATTGGACCTCGATGCGTCGCTGCGACTGTGGGAAAGAGGGGAGCAACTCGCCAAAAGGTGCGAGGAGCACTTAGCTGGTGCACGCCAGCGGGTGTCCGATGTGCTGGCCGGCGACGAGGCCCAAAACGGCTAA |
| Sequence | MVCDPNGDDTGRTHATVPVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGARQRVSDVLAGDEAQNG |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 19200449 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | C1AMA1 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 96
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1233966 | 1234223 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1252134 | 1252391 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 339410 | 339682 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 4 | 3252180 | 3252428 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 5 | 709433 | 709678 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 6 | 1797955 | 1798212 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 7 | 1605336 | 1605584 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 8 | 196314 | 196562 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 9 | 4938608 | 4938856 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 10 | 3257806 | 3258063 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 11 | 4388424 | 4388681 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 12 | 4916444 | 4916692 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 13 | 3948775 | 3949035 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 14 | 5367019 | 5367264 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 15 | 2665641 | 2665862 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 16 | 2398519 | 2398755 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 17 | 4198555 | 4198803 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 18 | 5193455 | 5193703 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 19 | 2193020 | 2193247 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 20 | 2271350 | 2271586 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 21 | 1110788 | 1111036 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 22 | 2869729 | 2869965 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 23 | 2941460 | 2941696 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 24 | 1102615 | 1102869 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 25 | 2859935 | 2860168 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 26 | 851722 | 851964 | + | NZ_AP022562.1 | Mycobacterium novum |
| 27 | 1132448 | 1132690 | - | NC_015576.1 | Mycolicibacter sinensis |
| 28 | 39119 | 39349 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 29 | 1108931 | 1109170 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 30 | 3401108 | 3401323 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 31 | 5285776 | 5285988 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 32 | 1844162 | 1844374 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 33 | 2621142 | 2621372 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 34 | 3566203 | 3566415 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 35 | 3921875 | 3922114 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 36 | 2844457 | 2844726 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 37 | 1749618 | 1749830 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 38 | 575792 | 576004 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 39 | 5026848 | 5027066 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 40 | 2276892 | 2277149 | + | NZ_CP015961.1 | Dietzia timorensis |
| 41 | 3227107 | 3227319 | + | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 42 | 5168851 | 5169063 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 43 | 1351990 | 1352199 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 44 | 4934803 | 4935015 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 45 | 1245171 | 1245380 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 46 | 62726 | 62938 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 47 | 260339 | 260551 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 48 | 4427059 | 4427313 | + | NZ_CP059694.1 | Gordonia rubripertincta |
| 49 | 1553627 | 1553842 | - | NZ_CP027793.1 | Rhodococcus hoagii |
| 50 | 983164 | 983430 | - | NC_021915.1 | Corynebacterium maris DSM 45190 |
| 51 | 5730249 | 5730461 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 52 | 2223001 | 2223234 | + | NZ_CP015449.1 | Dietzia lutea |
| 53 | 1262782 | 1263003 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 54 | 4297073 | 4297330 | + | NZ_CP027114.1 | Gordonia alkanivorans |
| 55 | 1768154 | 1768381 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 56 | 1749508 | 1749747 | - | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 57 | 961996 | 962274 | - | NZ_CP033896.1 | Corynebacterium choanae |
| 58 | 1177457 | 1177699 | - | NZ_CP011542.1 | Corynebacterium mustelae |
| 59 | 4065370 | 4065612 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 60 | 1084121 | 1084369 | - | NZ_CP004353.1 | Corynebacterium vitaeruminis DSM 20294 |
| 61 | 833136 | 833393 | - | NZ_LN831026.1 | Corynebacterium diphtheriae |
| 62 | 873387 | 873644 | - | NZ_LR738855.1 | Corynebacterium rouxii |
| 63 | 924432 | 924662 | - | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 64 | 954861 | 955121 | - | NZ_CP006764.1 | Corynebacterium doosanense CAU 212 = DSM 45436 |
| 65 | 1023086 | 1023310 | - | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 66 | 829035 | 829295 | - | NZ_CP033897.1 | Corynebacterium gerontici |
| 67 | 1295549 | 1295782 | - | NZ_CP011853.1 | Gordonia phthalatica |
| 68 | 1020337 | 1020600 | - | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 69 | 923284 | 923505 | - | NZ_CP008953.1 | Amycolatopsis japonica |
| 70 | 7692655 | 7692876 | + | NC_021252.1 | Amycolatopsis keratiniphila |
| 71 | 1016627 | 1016872 | - | NZ_CP009220.1 | Corynebacterium deserti GIMN1.010 |
| 72 | 1224896 | 1225141 | - | NZ_AP017369.1 | Corynebacterium suranareeae |
| 73 | 1819989 | 1820219 | + | NC_021663.1 | Corynebacterium terpenotabidum Y-11 |
| 74 | 818251 | 818553 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
| 75 | 820891 | 821151 | - | NZ_CP011546.1 | Corynebacterium uterequi |
| 76 | 1292798 | 1293031 | - | NZ_CP016174.1 | Amycolatopsis orientalis |
| 77 | 1613368 | 1613619 | + | NZ_CP026947.1 | Corynebacterium yudongzhengii |
| 78 | 4004054 | 4004296 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 79 | 1712398 | 1712661 | + | NZ_CP011312.1 | Corynebacterium kutscheri |
| 80 | 927521 | 927766 | - | NZ_CP011541.1 | Corynebacterium epidermidicanis |
| 81 | 576944 | 577240 | + | NZ_CP014635.1 | Corynebacterium simulans |
| 82 | 6257106 | 6257327 | - | NZ_CP070326.1 | Streptomyces noursei |
| 83 | 2662377 | 2662619 | + | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 84 | 9586522 | 9586767 | + | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 85 | 2898063 | 2898290 | - | NZ_CP060713.1 | Nocardioides mesophilus |
| 86 | 5421306 | 5421554 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 87 | 2621458 | 2621712 | - | NZ_CP018135.1 | Neomicrococcus aestuarii |
| 88 | 5754959 | 5755177 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 89 | 2152003 | 2152212 | - | NZ_CP015079.1 | Nocardioides dokdonensis FR1436 |
| 90 | 5010863 | 5011111 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 91 | 2528176 | 2528400 | - | NZ_CP049255.1 | Microbacterium endophyticum |
| 92 | 1794001 | 1794240 | + | NZ_CP028129.1 | Rathayibacter rathayi |
| 93 | 4143342 | 4143560 | + | NZ_CP022295.1 | Nocardioides aromaticivorans |
| 94 | 4002243 | 4002455 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 95 | 1967891 | 1968148 | - | NZ_CP035491.1 | Agromyces protaetiae |
| 96 | 5494526 | 5494747 | - | NZ_CP019457.1 | Streptomyces lydicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022576.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13742.8 | 1.0 | 96 | -3.0 | same-strand | OB-fold nucleic acid binding domain |
| 2 | PF01336.27 | 0.76 | 73 | -3 | same-strand | OB-fold nucleic acid binding domain |
| 3 | PF02401.20 | 0.96 | 92 | 1913.5 | opposite-strand | LytB protein |
| 4 | PF14030.8 | 0.64 | 61 | 822 | opposite-strand | Protein of unknown function (DUF4245) |
++ More..