Result : C1A8X3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | AP009153.1 |
| Organism | Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) |
| Left | 1961856 |
| Right | 1962038 |
| Strand | - |
| Nucleotide Sequence | ATGGCCGTACCAAAGCGCCGCACATCCAAGCGGCGGAAGCGCGCCCGCAACACGCACAAGGTAGCGCCCGCCATCGTGATCCAGTCGTGCCCGCAGTGTAGCGCCGCGAAGCGTCCGCATCGTGTCTGTGCGGAATGCGGTTACTACGCGGGTGAGCAGCGGGTAGCGGCGCAGGAAGCATAA |
| Sequence | MAVPKRRTSKRRKRARNTHKVAPAIVIQSCPQCSAAKRPHRVCAECGYYAGEQRVAAQEA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C1A8X3 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 174
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1961856 | 1962038 | - | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 2 | 2149330 | 2149512 | - | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 3 | 3796690 | 3796872 | - | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
| 4 | 965295 | 965477 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 5 | 2175466 | 2175648 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 6 | 813582 | 813761 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 7 | 1579599 | 1579781 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 8 | 1900192 | 1900371 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 9 | 2183816 | 2183989 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 10 | 1275152 | 1275334 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 11 | 1052967 | 1053140 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 12 | 2840264 | 2840440 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 13 | 714458 | 714634 | + | NZ_CP023434.1 | Suicoccus acidiformans |
| 14 | 1202959 | 1203141 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 15 | 1498932 | 1499114 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 16 | 695115 | 695303 | + | NZ_CP029256.1 | Christensenella minuta |
| 17 | 1421752 | 1421934 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 18 | 1498647 | 1498829 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 19 | 2777768 | 2777947 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 20 | 1548425 | 1548607 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 21 | 1646701 | 1646886 | + | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 22 | 1113778 | 1113951 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 23 | 2951180 | 2951356 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 24 | 964064 | 964240 | + | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 25 | 1153792 | 1153971 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 26 | 406708 | 406887 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 27 | 1094202 | 1094369 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 28 | 2085910 | 2086083 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 29 | 878822 | 878995 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 30 | 1325807 | 1325986 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 31 | 1591605 | 1591787 | - | NZ_CP034118.1 | Staphylospora marina |
| 32 | 1513040 | 1513213 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 33 | 1804192 | 1804368 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 34 | 1598936 | 1599109 | + | NZ_CP027770.1 | Staphylococcus felis |
| 35 | 1372908 | 1373087 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 36 | 1038074 | 1038253 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 37 | 1043854 | 1044036 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 38 | 2501011 | 2501193 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 39 | 2660163 | 2660336 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 40 | 743797 | 743970 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 41 | 725284 | 725457 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 42 | 1788692 | 1788865 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 43 | 875114 | 875293 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 44 | 99725 | 99898 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 45 | 1972044 | 1972217 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 46 | 1333899 | 1334081 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 47 | 1312099 | 1312281 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 48 | 1402224 | 1402421 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 49 | 430308 | 430487 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 50 | 1184675 | 1184857 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 51 | 3419714 | 3419890 | + | NZ_CP021434.1 | Tumebacillus avium |
| 52 | 1178578 | 1178751 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 53 | 190854 | 191027 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 54 | 1618210 | 1618383 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 55 | 1759050 | 1759223 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 56 | 2780422 | 2780598 | - | NZ_CP019870.1 | Clostridioides difficile |
| 57 | 1453976 | 1454152 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 58 | 396721 | 396903 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 59 | 1364049 | 1364225 | - | NZ_LR778174.1 | Veillonella parvula |
| 60 | 1079139 | 1079312 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 61 | 1810950 | 1811123 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 62 | 1696022 | 1696195 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 63 | 433997 | 434170 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 64 | 797674 | 797847 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 65 | 2284769 | 2284942 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 66 | 1725429 | 1725602 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 67 | 651573 | 651746 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 68 | 1879593 | 1879766 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 69 | 1091134 | 1091307 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 70 | 1889422 | 1889595 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 71 | 1579642 | 1579809 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 72 | 1252230 | 1252406 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 73 | 1305974 | 1306150 | - | NZ_LR134375.1 | Veillonella dispar |
| 74 | 1718848 | 1719021 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 75 | 2395242 | 2395424 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 76 | 1678088 | 1678261 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 77 | 1269641 | 1269823 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 78 | 1028027 | 1028200 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 79 | 930365 | 930538 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 80 | 1112459 | 1112632 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 81 | 1554843 | 1555013 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 82 | 1435564 | 1435746 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 83 | 1323746 | 1323928 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 84 | 4250446 | 4250622 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 85 | 1875858 | 1876043 | + | NZ_CP030032.1 | Bradymonas sediminis |
| 86 | 1427744 | 1427917 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 87 | 362568 | 362747 | + | NZ_CP025257.1 | Mesoplasma syrphidae |
| 88 | 725564 | 725740 | - | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 89 | 719224 | 719400 | - | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 90 | 2946506 | 2946682 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 91 | 797570 | 797746 | + | NZ_LT906470.1 | Veillonella rodentium |
| 92 | 2707246 | 2707419 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 93 | 1901972 | 1902148 | + | NZ_CP036259.1 | Sporomusa termitida |
| 94 | 1856055 | 1856228 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 95 | 822488 | 822661 | + | NZ_LR134483.1 | Listeria grayi |
| 96 | 1187851 | 1188033 | - | NZ_CP063849.1 | Paludibaculum fermentans |
| 97 | 821241 | 821417 | - | NZ_CP017015.1 | Spiroplasma helicoides |
| 98 | 3302786 | 3302959 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 99 | 2820684 | 2820857 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 100 | 2285039 | 2285215 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 101 | 1557793 | 1557969 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 102 | 1346892 | 1347065 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 103 | 548946 | 549122 | + | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 104 | 1693545 | 1693721 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 105 | 3925484 | 3925678 | - | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 106 | 2754307 | 2754480 | - | NZ_LS483476.1 | Lederbergia lentus |
| 107 | 266975 | 267154 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 108 | 2474162 | 2474335 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 109 | 1931525 | 1931698 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 110 | 3848721 | 3848894 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 111 | 1043147 | 1043323 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 112 | 2660917 | 2661090 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 113 | 2873238 | 2873411 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 114 | 1709708 | 1709881 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 115 | 937743 | 937916 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 116 | 3732798 | 3732971 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 117 | 457946 | 458116 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 118 | 318214 | 318393 | + | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 119 | 3019920 | 3020105 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 120 | 1512956 | 1513132 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 121 | 2242608 | 2242781 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 122 | 2185942 | 2186118 | - | NZ_CP016540.2 | Planococcus versutus |
| 123 | 2171747 | 2171923 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 124 | 2276097 | 2276273 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 125 | 2942780 | 2942956 | + | NZ_CP013661.2 | Planococcus kocurii |
| 126 | 2320740 | 2320916 | - | NZ_CP019401.1 | Planococcus faecalis |
| 127 | 2462749 | 2462925 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 128 | 2458486 | 2458671 | - | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 129 | 2534925 | 2535104 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 130 | 2580181 | 2580351 | + | NZ_CP026363.1 | Brevibacillus agri |
| 131 | 2370650 | 2370820 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 132 | 5057461 | 5057634 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 133 | 896379 | 896558 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 134 | 569247 | 569420 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 135 | 2855137 | 2855310 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 136 | 220255 | 220428 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 137 | 1124474 | 1124647 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 138 | 1714420 | 1714614 | + | NZ_AP014924.1 | Limnochorda pilosa |
| 139 | 354243 | 354428 | - | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 140 | 1033955 | 1034146 | + | NZ_LR134379.1 | Slackia heliotrinireducens |
| 141 | 407751 | 407936 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 142 | 3354483 | 3354668 | + | NZ_CP032819.1 | Butyricimonas faecalis |
| 143 | 661046 | 661228 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 144 | 374293 | 374442 | - | NC_012115.1 | Nautilia profundicola AmH |
| 145 | 1519180 | 1519329 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 146 | 2471199 | 2471372 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 147 | 42176 | 42349 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 148 | 4476197 | 4476394 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 149 | 922348 | 922533 | - | NZ_CP024727.1 | Prevotella intermedia |
| 150 | 384396 | 384545 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 151 | 1418001 | 1418177 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 152 | 912440 | 912613 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 153 | 1054381 | 1054554 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 154 | 5444947 | 5445120 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 155 | 3286658 | 3286831 | + | NZ_CP034437.1 | Paenibacillus albus |
| 156 | 2776749 | 2776922 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 157 | 2539668 | 2539841 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 158 | 2608753 | 2608926 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 159 | 3024857 | 3025030 | + | NZ_CP009288.1 | Paenibacillus durus |
| 160 | 3026616 | 3026789 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 161 | 5261909 | 5262082 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 162 | 3355085 | 3355258 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 163 | 5260224 | 5260397 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 164 | 3732024 | 3732197 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 165 | 3847434 | 3847607 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 166 | 2224137 | 2224310 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 167 | 1040970 | 1041143 | + | NZ_CP033433.1 | Cohnella candidum |
| 168 | 6132588 | 6132761 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 169 | 4085269 | 4085442 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 170 | 4003695 | 4003868 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 171 | 4336941 | 4337114 | - | NZ_AP019400.1 | Cohnella abietis |
| 172 | 1425027 | 1425194 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 173 | 1735054 | 1735227 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 174 | 868472 | 868645 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02620.19 | 0.9 | 157 | 47 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 2 | PF05636.13 | 0.64 | 112 | 765.5 | opposite-strand | HIGH Nucleotidyl Transferase |
++ More..