Result : C1A6R3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | AP009153.1 |
| Organism | Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) |
| Left | 1052412 |
| Right | 1052615 |
| Strand | + |
| Nucleotide Sequence | ATGAAGGCTGAAGAAATCCGCGGACTCGCTGACGACGAACTCGTCGCCCGCGTGCTGGAACTGGAAGAGGAGCGTTTCCGTCTCCGGTTCCGTAGCGGCACCGAAGCGCTTGAAGAGCCGCTGCGGTTGCGCAGCATCCGCAGGGACATTGCGCGCCTCAAGACGGTGCAGCGTGAGCGTCAGCTCGCTGCTCGTGGCCGCTAA |
| Sequence | MKAEEIRGLADDELVARVLELEEERFRLRFRSGTEALEEPLRLRSIRRDIARLKTVQRERQLAARGR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C1A6R3 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 181
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1052412 | 1052615 | + | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 2 | 1250646 | 1250849 | + | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 3 | 2745838 | 2746059 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 4 | 1898935 | 1899156 | + | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 5 | 647916 | 648113 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 6 | 805692 | 805898 | - | NZ_LT635475.1 | Ezakiella massiliensis |
| 7 | 2863649 | 2863858 | + | NZ_CP036402.1 | Egibacter rhizosphaerae |
| 8 | 3433758 | 3433979 | - | NZ_AP014924.1 | Limnochorda pilosa |
| 9 | 2713810 | 2714034 | - | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 10 | 2772301 | 2772498 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 11 | 1889593 | 1889826 | - | NZ_CP019606.1 | Tessaracoccus aquimaris |
| 12 | 1050682 | 1050882 | + | NZ_CP061800.1 | Desulfonema magnum |
| 13 | 224366 | 224563 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 14 | 413766 | 413999 | + | NZ_CP060789.1 | Tessaracoccus defluvii |
| 15 | 2634665 | 2634898 | + | NZ_LR214441.1 | Tessaracoccus lapidicaptus |
| 16 | 1438405 | 1438611 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 17 | 616379 | 616612 | - | NZ_CP019607.1 | Tessaracoccus flavescens |
| 18 | 1318653 | 1318859 | - | NZ_LT635480.1 | Ndongobacter massiliensis |
| 19 | 4573303 | 4573506 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 20 | 2069078 | 2069287 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 21 | 1512220 | 1512411 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 22 | 4043688 | 4043891 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 23 | 2493451 | 2493654 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 24 | 2126558 | 2126794 | + | NZ_CP068168.1 | Corynebacterium amycolatum |
| 25 | 3096340 | 3096540 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 26 | 472383 | 472619 | + | NZ_CP006841.1 | Corynebacterium lactis RW2-5 |
| 27 | 3369266 | 3369469 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 28 | 2965839 | 2966063 | - | NZ_CP034279.1 | Streptomyces ficellus |
| 29 | 3270623 | 3270835 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 30 | 132214 | 132414 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 31 | 2825866 | 2826066 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 32 | 140921 | 141121 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 33 | 2263947 | 2264147 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 34 | 3274484 | 3274708 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 35 | 3261328 | 3261528 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 36 | 2073726 | 2073962 | - | NZ_CP054938.1 | Streptomyces harbinensis |
| 37 | 6313346 | 6313546 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 38 | 4496811 | 4497011 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 39 | 247718 | 247918 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 40 | 203905 | 204105 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 41 | 619573 | 619797 | + | NZ_CP030862.1 | Streptomyces globosus |
| 42 | 563994 | 564197 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 43 | 3268666 | 3268866 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 44 | 6055463 | 6055663 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 45 | 132617 | 132817 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 46 | 2424593 | 2424826 | - | NZ_LR134406.1 | Arachnia propionica |
| 47 | 138039 | 138239 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 48 | 170519 | 170719 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 49 | 146504 | 146704 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 50 | 4683329 | 4683553 | + | NZ_CP023695.1 | Streptomyces alboniger |
| 51 | 4057130 | 4057354 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 52 | 3725978 | 3726202 | - | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 53 | 1512234 | 1512443 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 54 | 48200 | 48412 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 55 | 2935467 | 2935691 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 56 | 4779887 | 4780111 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 57 | 4766971 | 4767195 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 58 | 3564020 | 3564244 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
| 59 | 4021737 | 4021961 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 60 | 3648725 | 3648949 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 61 | 5992008 | 5992232 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 62 | 5677298 | 5677522 | + | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 63 | 143151 | 143351 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 64 | 225578 | 225778 | - | NZ_CP034437.1 | Paenibacillus albus |
| 65 | 4222306 | 4222506 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 66 | 4740022 | 4740222 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 67 | 3497542 | 3497766 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 68 | 4653447 | 4653671 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 69 | 4852371 | 4852595 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 70 | 4877596 | 4877820 | + | NZ_CP070242.1 | Streptomyces californicus |
| 71 | 4960904 | 4961128 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 72 | 4937399 | 4937623 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 73 | 3593025 | 3593249 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 74 | 3329745 | 3329969 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 75 | 3790457 | 3790657 | - | NZ_CP011937.1 | Bacillus velezensis |
| 76 | 275912 | 276112 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 77 | 140884 | 141084 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 78 | 139625 | 139825 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 79 | 109645 | 109845 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 80 | 1869577 | 1869777 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 81 | 139924 | 140124 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 82 | 1197906 | 1198106 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 83 | 1488434 | 1488634 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 84 | 113204 | 113404 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 85 | 1405500 | 1405700 | - | NZ_CP043404.1 | Bacillus safensis |
| 86 | 2074785 | 2075012 | - | NZ_LT985188.1 | Micropruina glycogenica |
| 87 | 2767656 | 2767880 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 88 | 155853 | 156053 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 89 | 2454463 | 2454648 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 90 | 5781417 | 5781659 | - | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 91 | 2245727 | 2245963 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
| 92 | 2748460 | 2748684 | - | NZ_CP031194.1 | Streptomyces paludis |
| 93 | 139865 | 140065 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 94 | 139751 | 139951 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 95 | 1654562 | 1654750 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 96 | 1656655 | 1656837 | - | NZ_CP060717.1 | Sphingomonas rhizophila |
| 97 | 3595514 | 3595711 | + | NZ_CP016428.1 | Bradyrhizobium icense |
| 98 | 3010213 | 3010410 | + | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
| 99 | 184965 | 185165 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 100 | 124152 | 124352 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 101 | 1726007 | 1726216 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 102 | 1767067 | 1767276 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 103 | 708665 | 708874 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 104 | 1282666 | 1282875 | + | NZ_CP027770.1 | Staphylococcus felis |
| 105 | 1977241 | 1977450 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 106 | 1511148 | 1511357 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 107 | 206044 | 206253 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 108 | 712381 | 712590 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 109 | 1435000 | 1435209 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 110 | 759088 | 759297 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 111 | 1056173 | 1056382 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 112 | 1781177 | 1781386 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 113 | 758584 | 758793 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 114 | 772725 | 772934 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 115 | 2236387 | 2236596 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 116 | 790239 | 790448 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 117 | 726089 | 726298 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 118 | 2167698 | 2167907 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 119 | 899624 | 899833 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 120 | 2198301 | 2198510 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 121 | 2691047 | 2691256 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 122 | 792781 | 792990 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 123 | 2269170 | 2269379 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 124 | 2313310 | 2313519 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 125 | 3393455 | 3393688 | - | NZ_CP011853.1 | Gordonia phthalatica |
| 126 | 648718 | 648927 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 127 | 613711 | 613920 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 128 | 1976354 | 1976563 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 129 | 476082 | 476279 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 130 | 1631193 | 1631396 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 131 | 5157694 | 5157891 | + | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 132 | 4056826 | 4057023 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 133 | 4717165 | 4717362 | - | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 134 | 5334844 | 5335077 | + | NZ_CP033972.1 | Gordonia insulae |
| 135 | 2012442 | 2012627 | - | NC_006085.1 | Cutibacterium acnes KPA171202 |
| 136 | 5723151 | 5723348 | + | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 137 | 1440165 | 1440359 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 138 | 125979 | 126182 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 139 | 132555 | 132758 | + | NZ_LS483476.1 | Lederbergia lentus |
| 140 | 3027263 | 3027460 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 141 | 3058325 | 3058537 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
| 142 | 477393 | 477587 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 143 | 1274294 | 1274491 | + | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 144 | 536376 | 536606 | + | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 145 | 3427076 | 3427273 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 146 | 5867613 | 5867810 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 147 | 5590085 | 5590282 | - | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 148 | 4198199 | 4198396 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 149 | 6281486 | 6281683 | - | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 150 | 3966912 | 3967109 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 151 | 2720246 | 2720473 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 152 | 111312 | 111521 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 153 | 6126853 | 6127050 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 154 | 2993201 | 2993398 | + | NC_017082.1 | Bradyrhizobium cosmicum |
| 155 | 7035917 | 7036114 | - | NZ_CP039690.1 | Phreatobacter stygius |
| 156 | 1987926 | 1988159 | + | NZ_CP027114.1 | Gordonia alkanivorans |
| 157 | 7086 | 7319 | - | NZ_CP059694.1 | Gordonia rubripertincta |
| 158 | 4035918 | 4036151 | - | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 159 | 3992142 | 3992375 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 160 | 2898191 | 2898394 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 161 | 713131 | 713361 | + | NZ_AP017369.1 | Corynebacterium suranareeae |
| 162 | 565757 | 565987 | + | NZ_CP009220.1 | Corynebacterium deserti GIMN1.010 |
| 163 | 556521 | 556751 | + | NZ_CP015622.1 | Corynebacterium crudilactis |
| 164 | 1198150 | 1198377 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 165 | 566977 | 567207 | + | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 166 | 5887433 | 5887660 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 167 | 2406362 | 2406589 | + | NZ_CP043474.1 | Mycobacterium grossiae |
| 168 | 579383 | 579610 | + | NZ_CP013290.1 | Janibacter indicus |
| 169 | 3274248 | 3274430 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 170 | 3747161 | 3747394 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 171 | 636332 | 636553 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 172 | 1123703 | 1123924 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 173 | 2725264 | 2725467 | - | NZ_CP015453.1 | Dietzia psychralcaliphila |
| 174 | 7627152 | 7627394 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 175 | 1130450 | 1130683 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 176 | 2854617 | 2854811 | - | NZ_CP033325.1 | Georgenia faecalis |
| 177 | 318103 | 318300 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 178 | 1215654 | 1215890 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 179 | 4332518 | 4332760 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
| 180 | 1780916 | 1781122 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 181 | 838373 | 838570 | - | NC_015320.1 | Archaeoglobus veneficus SNP6 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012489.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03947.20 | 0.99 | 180 | 1835.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 2 | PF00181.25 | 0.99 | 180 | 1835.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 3 | PF00203.23 | 0.99 | 180 | 1531.0 | same-strand | Ribosomal protein S19 |
| 4 | PF00237.21 | 1.0 | 181 | 1159 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00189.22 | 1.0 | 181 | 427 | same-strand | Ribosomal protein S3, C-terminal domain |
| 6 | PF07650.19 | 1.0 | 181 | 427 | same-strand | KH domain |
| 7 | PF00252.20 | 0.99 | 180 | 0.0 | same-strand | Ribosomal protein L16p/L10e |
| 8 | PF00366.22 | 1.0 | 181 | 14 | same-strand | Ribosomal protein S17 |
| 9 | PF00238.21 | 0.89 | 161 | 335 | same-strand | Ribosomal protein L14p/L23e |
| 10 | PF17136.6 | 0.86 | 155 | 732 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 11 | PF00467.31 | 0.78 | 141 | 733.0 | same-strand | KOW motif |
| 12 | PF00673.23 | 0.86 | 155 | 1071 | same-strand | ribosomal L5P family C-terminus |
| 13 | PF00281.21 | 0.86 | 155 | 1071 | same-strand | Ribosomal protein L5 |
| 14 | PF00253.23 | 0.78 | 141 | 1632 | same-strand | Ribosomal protein S14p/S29e |
++ More..