Result : A1STV0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | YcgL domain-containing protein Ping_1076 |
| NCBI Accession ID | CP000510.1 |
| Organism | Psychromonas ingrahamii (strain 37) |
| Left | 1348769 |
| Right | 1349065 |
| Strand | - |
| Nucleotide Sequence | ATGTTATGTGCTGTATATAAAAGTATTCGAAAATCGCAGACTTATCTGTTTATTGCAAAACGTGATGATTTCTCTTCAGTACCGGAACCACTACTGGCACAATTTGGTCCGCCGCAGTTGGTCTCTTTATTAAATATTACTTTGCAGACAAAATTTGCTATGGCAGAGGCTGAGAAAGTACTCTCTGCAGTGAAAAATAATGGTTATTATCTGCAACTTCCTCCTCCCCCGGTTAATCATCTGCAAGAACACAAAGACTGGAAAAAAAAACGGCAGGAGAATAAAAATGAAATCTGA |
| Sequence | MLCAVYKSIRKSQTYLFIAKRDDFSSVPEPLLAQFGPPQLVSLLNITLQTKFAMAEAEKVLSAVKNNGYYLQLPPPPVNHLQEHKDWKKKRQENKNEI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure. |
| Pubmed ID | |
| Domain | CDD:419850 |
| Functional Category | Others |
| Uniprot ID | A1STV0 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 82
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1348769 | 1349065 | - | NC_008709.1 | Psychromonas ingrahamii 37 |
| 2 | 1893714 | 1894001 | + | NC_007954.1 | Shewanella denitrificans OS217 |
| 3 | 3655970 | 3656263 | - | NC_003910.7 | Colwellia psychrerythraea 34H |
| 4 | 4219680 | 4219970 | + | NZ_CP034759.1 | Litorilituus sediminis |
| 5 | 745280 | 745558 | + | NZ_CP044060.1 | Aeromonas veronii |
| 6 | 2987344 | 2987625 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 7 | 1422667 | 1422945 | + | NZ_CP040449.1 | Aeromonas simiae |
| 8 | 2357226 | 2357504 | - | NC_008700.1 | Shewanella amazonensis SB2B |
| 9 | 2279841 | 2280119 | - | NZ_CP069213.1 | Shewanella litorisediminis |
| 10 | 1003011 | 1003301 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 11 | 2514805 | 2515074 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 12 | 2272076 | 2272354 | + | NC_016901.1 | Shewanella baltica OS678 |
| 13 | 914424 | 914702 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 14 | 1033321 | 1033599 | - | NZ_CP041783.1 | Shewanella donghaensis |
| 15 | 3728056 | 3728325 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 16 | 1902782 | 1903063 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 17 | 2390125 | 2390406 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 18 | 2714234 | 2714512 | - | NZ_CP020472.1 | Shewanella japonica |
| 19 | 2590237 | 2590518 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 20 | 2957840 | 2958115 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 21 | 2018769 | 2019050 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 22 | 2194045 | 2194326 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 23 | 2543261 | 2543542 | - | NC_009092.1 | Shewanella loihica PV-4 |
| 24 | 2482741 | 2483016 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 25 | 2283211 | 2283489 | + | NZ_AP022188.1 | Aeromonas media |
| 26 | 2453458 | 2453739 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 27 | 926767 | 927042 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 28 | 2221173 | 2221445 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 29 | 2427603 | 2427881 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 30 | 1862497 | 1862775 | - | NZ_CP020373.1 | Shewanella khirikhana |
| 31 | 2249344 | 2249619 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 32 | 1658421 | 1658696 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 33 | 2147134 | 2147412 | + | NZ_LR134376.1 | Aeromonas encheleia |
| 34 | 1494823 | 1495098 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 35 | 2070481 | 2070759 | + | NZ_CP022358.1 | Shewanella bicestrii |
| 36 | 716039 | 716320 | + | NZ_CP021376.1 | Oceanisphaera avium |
| 37 | 3029835 | 3030107 | - | NZ_LR134494.1 | Serratia quinivorans |
| 38 | 1584968 | 1585249 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 39 | 1988904 | 1989179 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 40 | 585485 | 585766 | + | NZ_CP072135.1 | Pseudoalteromonas xiamenensis |
| 41 | 147153 | 147428 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 42 | 1923025 | 1923306 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 43 | 2015095 | 2015376 | + | NZ_CP041247.1 | Raoultella electrica |
| 44 | 2703782 | 2704051 | + | NZ_CP029736.1 | Providencia rettgeri |
| 45 | 2526903 | 2527178 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 46 | 2564879 | 2565154 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 47 | 479096 | 479368 | + | NZ_CP009787.1 | Yersinia rohdei |
| 48 | 3489532 | 3489813 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 49 | 2175683 | 2175955 | + | NZ_CP071320.1 | Serratia ureilytica |
| 50 | 2923845 | 2924117 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 51 | 2139970 | 2140242 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 52 | 1945760 | 1946035 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 53 | 880604 | 880882 | - | NZ_CP009889.1 | Pseudoalteromonas piratica |
| 54 | 1217572 | 1217865 | + | NZ_AP014857.1 | Escherichia albertii |
| 55 | 2499704 | 2499976 | - | NZ_CP043727.1 | Yersinia canariae |
| 56 | 2828551 | 2828826 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 57 | 3029194 | 3029472 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 58 | 1911662 | 1911955 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 59 | 1824447 | 1824722 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 60 | 2036940 | 2037221 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 61 | 5178406 | 5178687 | - | NZ_CP026047.1 | Raoultella planticola |
| 62 | 2089605 | 2089886 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 63 | 304086 | 304367 | + | NZ_CP019628.1 | Pseudoalteromonas aliena |
| 64 | 815073 | 815366 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 65 | 392499 | 392780 | - | NZ_CP072426.1 | Pseudoalteromonas viridis |
| 66 | 285985 | 286260 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 67 | 2028740 | 2029012 | - | NZ_CP032487.1 | Yersinia hibernica |
| 68 | 4022626 | 4022898 | + | NZ_CP007230.1 | Yersinia similis |
| 69 | 1822543 | 1822815 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 70 | 1346654 | 1346938 | + | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 71 | 2158139 | 2158414 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 72 | 2234980 | 2235252 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 73 | 2447927 | 2448199 | - | NZ_CP048796.1 | Providencia vermicola |
| 74 | 2729075 | 2729353 | + | NZ_CP037952.1 | Parashewanella spongiae |
| 75 | 2530588 | 2530863 | - | NZ_CP026377.1 | Mixta gaviniae |
| 76 | 194763 | 195044 | + | NZ_CP032091.1 | Pseudoalteromonas donghaensis |
| 77 | 3690593 | 3690865 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 78 | 2407116 | 2407391 | - | NZ_CP061511.1 | Mixta calida |
| 79 | 696745 | 697035 | + | NZ_CP016604.1 | Otariodibacter oris |
| 80 | 3464329 | 3464604 | + | NZ_CP019706.1 | Pantoea alhagi |
| 81 | 574278 | 574565 | + | NZ_CP033066.1 | Pseudoalteromonas agarivorans |
| 82 | 716164 | 716451 | + | NZ_CP011029.1 | Pseudoalteromonas espejiana DSM 9414 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007954.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03692.17 | 0.82 | 67 | 1080 | same-strand | Putative zinc- or iron-chelating domain |
| 2 | PF13406.8 | 0.61 | 50 | 32.0 | same-strand | Transglycosylase SLT domain |
| 3 | PF03775.18 | 0.94 | 77 | 127 | opposite-strand | Septum formation inhibitor MinC, C-terminal domain |
| 4 | PF05209.15 | 0.94 | 77 | 127 | opposite-strand | Septum formation inhibitor MinC, N-terminal domain |
| 5 | PF13614.8 | 0.94 | 77 | 848 | opposite-strand | AAA domain |
| 6 | PF01656.25 | 0.94 | 77 | 848 | opposite-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 7 | PF03776.16 | 0.94 | 77 | 1662 | opposite-strand | Septum formation topological specificity factor MinE |
| 8 | PF00501.30 | 0.72 | 59 | 3225 | same-strand | AMP-binding enzyme |
| 9 | PF13193.8 | 0.72 | 59 | 3225 | same-strand | AMP-binding enzyme C-terminal domain |
| 10 | PF01612.22 | 0.78 | 64 | 2030.5 | same-strand | 3'-5' exonuclease |
| 11 | PF00570.25 | 0.79 | 65 | 2031 | same-strand | HRDC domain |
++ More..