Result : C0ZES4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0291 protein BBR47_33060 |
| NCBI Accession ID | AP008955.1 |
| Organism | Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) |
| Left | 3523088 |
| Right | 3523285 |
| Strand | - |
| Nucleotide Sequence | GTGGTATCTGACGCAGAAATTAAACGCATTAACGAATTGGTCAAAAAATCTCGCGAAGAAGGTTTAACCGAAGAGGAAAAGCTCGAGCAAAAAGCATTGCGCCAAAAGTACATTGACGCCGTTAAGCTTTCACTGAGAGCAAATTTGGATTCCATCCGTTATGTGGAAGACCTTGAAGAAAATAAGCCAAAACAGTAA |
| Sequence | MVSDAEIKRINELVKKSREEGLTEEEKLEQKALRQKYIDAVKLSLRANLDSIRYVEDLEENKPKQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01722. Profile Description: Bacterial protein of unknown function (DUF896). hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:413030 |
| Functional Category | Others |
| Uniprot ID | C0ZES4 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 20
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2594821 | 2595018 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 2 | 2769909 | 2770106 | + | NZ_CP026363.1 | Brevibacillus agri |
| 3 | 167601 | 167795 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 4 | 2047300 | 2047467 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 5 | 2440979 | 2441164 | - | NZ_CP014176.1 | Clostridium argentinense |
| 6 | 1601282 | 1601470 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 7 | 997257 | 997430 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 8 | 1059894 | 1060064 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 9 | 2652605 | 2652793 | + | NZ_CP020953.1 | Clostridium drakei |
| 10 | 1682373 | 1682561 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 11 | 1421948 | 1422136 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 12 | 3639371 | 3639574 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 13 | 1473226 | 1473402 | - | NZ_HG917868.1 | Clostridium bornimense |
| 14 | 2471223 | 2471420 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 15 | 1875554 | 1875742 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 16 | 3134002 | 3134211 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 17 | 1557835 | 1558005 | + | NZ_CP009687.1 | Clostridium aceticum |
| 18 | 1435556 | 1435735 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 19 | 306320 | 306502 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 20 | 2931911 | 2932099 | + | NZ_CP023671.1 | Clostridium septicum |
++ More..