Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L35 |
NCBI Accession ID | CP001357.1 |
Organism | Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) |
Left | 856536 |
Right | 856739 |
Strand | - |
Nucleotide Sequence | ATGAAACAAAAATTAAAAACAAAAAGCGGTGCAAAAAAACGTTTTAGATTTTCTAAGACTGGTAAAGTAAAATTTGCTCATGCATTTGGTAGCCACAAATTCTTAAGCAAAAGACCTGACACTAAAAGAAAGTATCGTAAAGCTAGAATAGCAGATGATACTAATATGTTAGAAATGCCAAGATTAATGCCTTACGGCAGATAA |
Sequence | MKQKLKTKSGAKKRFRFSKTGKVKFAHAFGSHKFLSKRPDTKRKYRKARIADDTNMLEMPRLMPYGR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
Pubmed ID | 19262690 |
Domain | CDD:412354 |
Functional Category | Ribosomal_protein |
Uniprot ID | C0QZD1 |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 575084 | 575287 | - | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
2 | 2937559 | 2937762 | + | NZ_CP019914.1 | Brachyspira hampsonii |
3 | 3211990 | 3212193 | + | NC_014150.1 | Brachyspira murdochii DSM 12563 |
4 | 2023226 | 2023429 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
5 | 614061 | 614264 | - | NZ_CP046932.1 | Brachyspira hyodysenteriae |
6 | 339019 | 339219 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
7 | 3454211 | 3454411 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
8 | 1562283 | 1562480 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
9 | 2974063 | 2974266 | + | NZ_CP048436.1 | Flavonifractor plautii |
10 | 6295290 | 6295484 | + | NC_015703.1 | Runella slithyformis DSM 19594 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00453.20 | 1.0 | 10 | 27.0 | same-strand | Ribosomal protein L20 |
2 | PF00707.24 | 0.9 | 9 | 92 | same-strand | Translation initiation factor IF-3, C-terminal domain |
3 | PF05198.18 | 0.9 | 9 | 92 | same-strand | Translation initiation factor IF-3, N-terminal domain |