Result : C0QZD1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | CP001357.1 |
| Organism | Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) |
| Left | 856536 |
| Right | 856739 |
| Strand | - |
| Nucleotide Sequence | ATGAAACAAAAATTAAAAACAAAAAGCGGTGCAAAAAAACGTTTTAGATTTTCTAAGACTGGTAAAGTAAAATTTGCTCATGCATTTGGTAGCCACAAATTCTTAAGCAAAAGACCTGACACTAAAAGAAAGTATCGTAAAGCTAGAATAGCAGATGATACTAATATGTTAGAAATGCCAAGATTAATGCCTTACGGCAGATAA |
| Sequence | MKQKLKTKSGAKKRFRFSKTGKVKFAHAFGSHKFLSKRPDTKRKYRKARIADDTNMLEMPRLMPYGR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19262690 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C0QZD1 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 575084 | 575287 | - | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
| 2 | 2937559 | 2937762 | + | NZ_CP019914.1 | Brachyspira hampsonii |
| 3 | 3211990 | 3212193 | + | NC_014150.1 | Brachyspira murdochii DSM 12563 |
| 4 | 2023226 | 2023429 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 5 | 614061 | 614264 | - | NZ_CP046932.1 | Brachyspira hyodysenteriae |
| 6 | 339019 | 339219 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 7 | 3454211 | 3454411 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 8 | 1562283 | 1562480 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 9 | 2974063 | 2974266 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 10 | 6295290 | 6295484 | + | NC_015703.1 | Runella slithyformis DSM 19594 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014330.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00453.20 | 1.0 | 10 | 27.0 | same-strand | Ribosomal protein L20 |
| 2 | PF00707.24 | 0.9 | 9 | 92 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 3 | PF05198.18 | 0.9 | 9 | 92 | same-strand | Translation initiation factor IF-3, N-terminal domain |
++ More..