Result : C0QWW9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L33 |
| NCBI Accession ID | CP001357.1 |
| Organism | Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) |
| Left | 2621709 |
| Right | 2621885 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGGTGCTAAAGTAAAAACAGAACAAATACATCTTCAATGCACAGAATGCAAAAGAAAGAATTATATAACAACAAAAAATAAACAAAATGTTCCAGAAAAATTGGAATTAAAAAAATATTGCCCTCATGATAAAAAACATACAATTCATAAGGAATTAAAAGTATCAAGATAA |
| Sequence | MAGAKVKTEQIHLQCTECKRKNYITTKNKQNVPEKLELKKYCPHDKKHTIHKELKVSR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00383. Profile Description: Ribosomal protein L33. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19262690 |
| Domain | CDD:412348 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C0QWW9 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 499
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2435662 | 2435838 | + | NZ_CP046932.1 | Brachyspira hyodysenteriae |
| 2 | 1097060 | 1097236 | - | NZ_CP019914.1 | Brachyspira hampsonii |
| 3 | 2689937 | 2690113 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 4 | 2225289 | 2225465 | + | NC_014150.1 | Brachyspira murdochii DSM 12563 |
| 5 | 1689602 | 1689778 | + | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
| 6 | 3409160 | 3409333 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 7 | 298838 | 299008 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 8 | 1113632 | 1113805 | + | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 9 | 2714930 | 2715103 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 10 | 4101898 | 4102047 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 11 | 424915 | 425088 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
| 12 | 1304305 | 1304454 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 13 | 24682 | 24846 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 14 | 2474635 | 2474784 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 15 | 240587 | 240739 | + | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 16 | 1691099 | 1691266 | + | NZ_CP011786.1 | Bifidobacterium actinocoloniiforme DSM 22766 |
| 17 | 238738 | 238902 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 18 | 465416 | 465586 | + | NC_022097.1 | Treponema pedis str. T A4 |
| 19 | 175265 | 175435 | - | NZ_CP009228.1 | Treponema putidum |
| 20 | 2729321 | 2729485 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 21 | 634213 | 634380 | + | NC_017093.1 | Actinoplanes missouriensis 431 |
| 22 | 2456212 | 2456382 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
| 23 | 1369577 | 1369726 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 24 | 1552751 | 1552915 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 25 | 2528311 | 2528460 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 26 | 2035161 | 2035337 | - | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 27 | 63163 | 63327 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 28 | 583287 | 583457 | + | NZ_AP012331.1 | Bifidobacterium scardovii JCM 12489 = DSM 13734 |
| 29 | 1678000 | 1678164 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 30 | 1460091 | 1460255 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 31 | 2009472 | 2009624 | - | NZ_CP010904.1 | Kiritimatiella glycovorans |
| 32 | 328286 | 328462 | + | NZ_CP054142.1 | Treponema parvum |
| 33 | 2475502 | 2475666 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 34 | 3462670 | 3462834 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 35 | 120562 | 120729 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 36 | 3092101 | 3092280 | - | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 37 | 1422189 | 1422356 | - | NZ_CP006018.1 | Bifidobacterium indicum LMG 11587 = DSM 20214 |
| 38 | 1459326 | 1459493 | - | NZ_CP007287.1 | Bifidobacterium coryneforme |
| 39 | 804117 | 804281 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 40 | 2338558 | 2338734 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 41 | 1475895 | 1476044 | + | NZ_CP011937.1 | Bacillus velezensis |
| 42 | 1569808 | 1569957 | + | NZ_CP011937.1 | Bacillus velezensis |
| 43 | 2543852 | 2544001 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 44 | 2447527 | 2447676 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 45 | 2523909 | 2524058 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 46 | 2448877 | 2449026 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 47 | 2434440 | 2434589 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 48 | 2574408 | 2574557 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 49 | 1358160 | 1358312 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 50 | 3519323 | 3519472 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 51 | 2513119 | 2513268 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 52 | 621185 | 621349 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 53 | 1718699 | 1718848 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 54 | 14868 | 15038 | + | NZ_CP049257.1 | Nocardioides anomalus |
| 55 | 1257466 | 1257630 | + | NZ_CP016312.1 | Thermus brockianus |
| 56 | 1980872 | 1981036 | + | NZ_CP038452.1 | Thermus caldilimi |
| 57 | 1308524 | 1308682 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 58 | 2329812 | 2329991 | + | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 59 | 2026958 | 2027107 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 60 | 1515747 | 1515896 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 61 | 900826 | 900975 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 62 | 1208797 | 1208946 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 63 | 2372037 | 2372186 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 64 | 3682339 | 3682488 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 65 | 70764 | 70913 | + | NZ_LT635455.1 | Olsenella timonensis |
| 66 | 975061 | 975228 | + | NC_022657.1 | Actinoplanes friuliensis DSM 7358 |
| 67 | 624825 | 624992 | + | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 68 | 1961545 | 1961712 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 69 | 4857910 | 4858077 | - | NZ_CP045309.1 | Micromonospora terminaliae |
| 70 | 1389102 | 1389251 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 71 | 450374 | 450523 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 72 | 2793821 | 2793970 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 73 | 355542 | 355691 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 74 | 1860557 | 1860706 | - | NC_014363.1 | Olsenella uli DSM 7084 |
| 75 | 1063653 | 1063802 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 76 | 2020364 | 2020513 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 77 | 1317436 | 1317585 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
| 78 | 1752401 | 1752568 | - | NC_018720.1 | Bifidobacterium asteroides PRL2011 |
| 79 | 358381 | 358551 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 80 | 1182843 | 1183013 | - | NZ_CP028105.1 | Fusobacterium ulcerans |
| 81 | 6204928 | 6205095 | - | NC_014391.1 | Micromonospora aurantiaca ATCC 27029 |
| 82 | 1713901 | 1714050 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 83 | 4524260 | 4524424 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 84 | 195475 | 195645 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 85 | 881499 | 881651 | - | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 86 | 997538 | 997690 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 87 | 1942269 | 1942436 | - | NZ_CP006712.1 | Bifidobacterium breve JCM 7017 |
| 88 | 1240146 | 1240295 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 89 | 1693553 | 1693702 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 90 | 604064 | 604222 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 91 | 885610 | 885759 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 92 | 1373815 | 1373964 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 93 | 1180005 | 1180154 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 94 | 289796 | 289945 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 95 | 1474548 | 1474697 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 96 | 4831802 | 4831966 | + | NZ_CP020700.1 | Streptomyces tsukubensis |
| 97 | 1273075 | 1273224 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 98 | 1390201 | 1390350 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 99 | 3838684 | 3838848 | + | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 100 | 3994305 | 3994469 | + | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 101 | 1430280 | 1430429 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 102 | 1310405 | 1310554 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 103 | 571944 | 572093 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 104 | 971343 | 971492 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 105 | 1676049 | 1676198 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 106 | 1663878 | 1664027 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 107 | 2292784 | 2292936 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 108 | 1399354 | 1399497 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 109 | 1137032 | 1137175 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 110 | 1020474 | 1020617 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 111 | 1231796 | 1231939 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 112 | 1623368 | 1623511 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 113 | 1350126 | 1350269 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 114 | 1621656 | 1621799 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 115 | 6007935 | 6008099 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 116 | 1260542 | 1260691 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 117 | 984158 | 984307 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 118 | 1853775 | 1853939 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 119 | 1812501 | 1812650 | - | NZ_CP027770.1 | Staphylococcus felis |
| 120 | 1502635 | 1502784 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 121 | 2483071 | 2483220 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 122 | 1302185 | 1302334 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 123 | 2937948 | 2938112 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 124 | 1716606 | 1716770 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 125 | 1300079 | 1300222 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 126 | 1059268 | 1059411 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 127 | 1138950 | 1139099 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 128 | 1947998 | 1948147 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 129 | 3107779 | 3107928 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 130 | 2267198 | 2267347 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 131 | 3019591 | 3019740 | + | NZ_CP043404.1 | Bacillus safensis |
| 132 | 1598435 | 1598584 | - | NC_015389.1 | Coriobacterium glomerans PW2 |
| 133 | 7460338 | 7460502 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 134 | 806664 | 806822 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 135 | 1725469 | 1725618 | + | NZ_LS483476.1 | Lederbergia lentus |
| 136 | 4474772 | 4474942 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 137 | 329764 | 329934 | - | NZ_LT996886.1 | Tessaracoccus timonensis |
| 138 | 2979659 | 2979823 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 139 | 2240844 | 2240993 | - | NZ_CP012024.1 | Bacillus smithii |
| 140 | 1056225 | 1056374 | + | NZ_CP012024.1 | Bacillus smithii |
| 141 | 998436 | 998585 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 142 | 2336081 | 2336230 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 143 | 2342340 | 2342483 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 144 | 1564681 | 1564830 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 145 | 1779703 | 1779852 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 146 | 783037 | 783186 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 147 | 177470 | 177619 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 148 | 2843243 | 2843404 | - | NZ_CP048649.1 | Aminipila butyrica |
| 149 | 1273704 | 1273853 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 150 | 1706636 | 1706800 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 151 | 407746 | 407895 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 152 | 404041 | 404205 | + | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 153 | 2014647 | 2014796 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 154 | 2814008 | 2814157 | - | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 155 | 2441062 | 2441211 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 156 | 202534 | 202683 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 157 | 197204 | 197353 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 158 | 246967 | 247110 | + | NZ_CP045851.1 | Actinomarinicola tropica |
| 159 | 1107826 | 1107990 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 160 | 2925993 | 2926142 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 161 | 2017671 | 2017820 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 162 | 3554879 | 3555028 | - | NZ_CP030775.1 | Clostridium butyricum |
| 163 | 174445 | 174594 | + | NZ_CP043998.1 | Clostridium diolis |
| 164 | 4081515 | 4081664 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 165 | 522711 | 522887 | + | NZ_CP031518.1 | Treponema ruminis |
| 166 | 308698 | 308865 | + | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 167 | 1525440 | 1525589 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 168 | 1342344 | 1342493 | + | NZ_LT906444.1 | Listeria welshimeri |
| 169 | 1363826 | 1363975 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 170 | 23026 | 23190 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 171 | 819668 | 819826 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 172 | 2481833 | 2481997 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 173 | 3694570 | 3694719 | - | NZ_CP028842.1 | Clostridium botulinum |
| 174 | 1386083 | 1386232 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 175 | 326749 | 326907 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 176 | 2353708 | 2353866 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 177 | 1108823 | 1108972 | - | NZ_CP047361.1 | Macrococcus canis |
| 178 | 1412753 | 1412902 | - | NZ_CP029256.1 | Christensenella minuta |
| 179 | 1192452 | 1192601 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 180 | 3253729 | 3253881 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 181 | 529989 | 530138 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 182 | 420686 | 420850 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 183 | 666717 | 666881 | + | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 184 | 3975715 | 3975864 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 185 | 766009 | 766173 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 186 | 216907 | 217056 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 187 | 2524456 | 2524632 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 188 | 2057300 | 2057470 | - | NC_006085.1 | Cutibacterium acnes KPA171202 |
| 189 | 2897874 | 2898023 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 190 | 2718107 | 2718256 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 191 | 3104447 | 3104596 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 192 | 2113421 | 2113570 | + | NZ_CP013661.2 | Planococcus kocurii |
| 193 | 3157748 | 3157897 | - | NZ_CP019401.1 | Planococcus faecalis |
| 194 | 3342654 | 3342803 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 195 | 2207517 | 2207666 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 196 | 1123930 | 1124082 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 197 | 1503756 | 1503905 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 198 | 2947514 | 2947663 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 199 | 1943238 | 1943390 | - | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 200 | 4573157 | 4573321 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 201 | 3218132 | 3218284 | + | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
| 202 | 1412244 | 1412393 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 203 | 193848 | 194000 | - | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 204 | 1800956 | 1801105 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 205 | 1279102 | 1279251 | - | NZ_CP011391.1 | Faecalibaculum rodentium |
| 206 | 5809032 | 5809181 | - | NZ_CP022753.1 | Nocardiopsis gilva YIM 90087 |
| 207 | 2140336 | 2140485 | - | NC_014836.1 | Desulfurispirillum indicum S5 |
| 208 | 250061 | 250210 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 209 | 537481 | 537654 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 210 | 864124 | 864273 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 211 | 312973 | 313116 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 212 | 2507356 | 2507505 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 213 | 478238 | 478396 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 214 | 453617 | 453775 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 215 | 878681 | 878845 | + | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 216 | 1843697 | 1843846 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 217 | 4225845 | 4226009 | + | NC_020990.1 | Streptomyces albidoflavus |
| 218 | 1400695 | 1400844 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 219 | 493704 | 493877 | + | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 220 | 702341 | 702511 | - | NZ_CP019607.1 | Tessaracoccus flavescens |
| 221 | 4291463 | 4291606 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 222 | 2718512 | 2718661 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 223 | 3602678 | 3602827 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 224 | 350767 | 350925 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 225 | 3756014 | 3756163 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 226 | 1457833 | 1457982 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 227 | 2434447 | 2434596 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 228 | 2297787 | 2297936 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 229 | 1376326 | 1376475 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 230 | 391149 | 391307 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 231 | 399052 | 399210 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 232 | 414076 | 414234 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 233 | 422516 | 422674 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 234 | 427601 | 427759 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 235 | 475973 | 476137 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 236 | 2006824 | 2006973 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 237 | 1218762 | 1218914 | + | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 238 | 1958185 | 1958334 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 239 | 2329863 | 2330012 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 240 | 1107501 | 1107659 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 241 | 1089178 | 1089336 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 242 | 2628811 | 2628987 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 243 | 1981237 | 1981386 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 244 | 4333047 | 4333196 | - | NZ_CP009288.1 | Paenibacillus durus |
| 245 | 511228 | 511377 | + | NZ_LT821227.1 | Phoenicibacter congonensis |
| 246 | 1655908 | 1656057 | + | NZ_LT635475.1 | Ezakiella massiliensis |
| 247 | 1262230 | 1262394 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 248 | 2998637 | 2998780 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 249 | 1545327 | 1545491 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 250 | 3097446 | 3097589 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 251 | 1508293 | 1508457 | + | NZ_CP016538.2 | Planococcus maritimus |
| 252 | 3111068 | 3111211 | - | NZ_CP016538.2 | Planococcus maritimus |
| 253 | 1518325 | 1518489 | + | NZ_CP059540.1 | Planococcus maritimus |
| 254 | 1861026 | 1861175 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 255 | 1251976 | 1252125 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 256 | 134056 | 134205 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 257 | 885668 | 885817 | - | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 258 | 410131 | 410289 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 259 | 621010 | 621162 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 260 | 3596256 | 3596420 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 261 | 1639667 | 1639816 | - | NZ_LT632322.1 | Murdochiella vaginalis |
| 262 | 69781 | 69930 | + | NZ_CP027228.1 | Mogibacterium diversum |
| 263 | 1682789 | 1682938 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 264 | 4566060 | 4566224 | + | NZ_CP023407.1 | Streptomyces fungicidicus |
| 265 | 21309 | 21461 | - | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 266 | 1569389 | 1569541 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 267 | 3188660 | 3188809 | - | NZ_CP030280.1 | Blautia argi |
| 268 | 791433 | 791582 | + | NC_022549.1 | Acholeplasma brassicae |
| 269 | 2992597 | 2992746 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 270 | 449093 | 449260 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 271 | 54285 | 54443 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 272 | 1309116 | 1309274 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 273 | 435660 | 435818 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 274 | 316235 | 316393 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 275 | 2171580 | 2171729 | + | NZ_LT996885.1 | Dialister massiliensis |
| 276 | 331806 | 331955 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 277 | 909 | 1079 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 278 | 359396 | 359566 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 279 | 1591704 | 1591874 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 280 | 1409375 | 1409533 | - | NZ_CP053826.1 | Campylobacter curvus |
| 281 | 369999 | 370148 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 282 | 604184 | 604354 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 283 | 5157192 | 5157356 | + | NZ_CP071839.1 | Streptomyces cyanogenus |
| 284 | 1268878 | 1269036 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 285 | 499407 | 499586 | + | NZ_CP024333.1 | Borrelia miyamotoi |
| 286 | 1016824 | 1016976 | + | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 287 | 4716576 | 4716740 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 288 | 5335119 | 5335283 | + | NZ_CP027306.1 | Streptomyces atratus |
| 289 | 1016338 | 1016502 | - | NZ_CP047156.1 | Epidermidibacterium keratini |
| 290 | 5952270 | 5952419 | - | NZ_CP039126.1 | Blautia producta |
| 291 | 3635117 | 3635281 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 292 | 1044287 | 1044451 | + | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 293 | 406801 | 406980 | - | NZ_CP044535.1 | Borrelia maritima |
| 294 | 740289 | 740441 | + | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
| 295 | 621745 | 621903 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 296 | 165534 | 165683 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 297 | 1378223 | 1378381 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 298 | 182306 | 182455 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 299 | 202343 | 202492 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 300 | 1394814 | 1394972 | - | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 301 | 116766 | 116918 | - | NZ_LR214970.1 | Mycoplasmopsis bovigenitalium |
| 302 | 409854 | 410033 | - | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 303 | 2512743 | 2512925 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 304 | 748846 | 748998 | - | NZ_CP034841.1 | Mycoplasmopsis phocirhinis |
| 305 | 3555120 | 3555269 | - | NZ_CP011853.1 | Gordonia phthalatica |
| 306 | 6553806 | 6553970 | + | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 307 | 355622 | 355780 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 308 | 388478 | 388642 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 309 | 455016 | 455174 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 310 | 420524 | 420703 | - | NZ_CP028884.1 | Borrelia turcica IST7 |
| 311 | 686596 | 686766 | + | NZ_CP059164.1 | Nocardioides ungokensis |
| 312 | 401726 | 401905 | - | NZ_CP013704.1 | Borrelia anserina Es |
| 313 | 1652467 | 1652637 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 314 | 370803 | 370961 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 315 | 406693 | 406872 | - | NC_015921.1 | Borreliella bissettii DN127 |
| 316 | 408979 | 409158 | - | NZ_CP015796.1 | Borreliella mayonii |
| 317 | 409588 | 409767 | - | NZ_CP028861.1 | Borreliella garinii |
| 318 | 3698829 | 3698978 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 319 | 510667 | 510837 | + | NZ_CP012544.1 | Campylobacter showae |
| 320 | 1915853 | 1916023 | - | NZ_CP012543.1 | Campylobacter rectus |
| 321 | 407181 | 407339 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 322 | 2219949 | 2220098 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 323 | 408404 | 408583 | - | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 324 | 408525 | 408704 | - | NC_008710.1 | Borrelia turicatae 91E135 |
| 325 | 540326 | 540475 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 326 | 756165 | 756335 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 327 | 3454397 | 3454561 | + | NZ_CP016793.1 | Lentzea guizhouensis |
| 328 | 1308883 | 1309053 | - | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
| 329 | 2198053 | 2198202 | + | NZ_LT828648.1 | Nitrospira japonica |
| 330 | 4255990 | 4256139 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 331 | 6774285 | 6774428 | - | NZ_CP012333.1 | Labilithrix luteola |
| 332 | 505652 | 505801 | - | NZ_CP012075.1 | Prevotella fusca JCM 17724 |
| 333 | 3717450 | 3717617 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 334 | 130179 | 130328 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 335 | 165005 | 165154 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 336 | 741490 | 741642 | - | NZ_CP030141.1 | Mycoplasmopsis anatis |
| 337 | 148332 | 148484 | + | NC_012115.1 | Nautilia profundicola AmH |
| 338 | 853367 | 853516 | + | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 339 | 577704 | 577853 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 340 | 400966 | 401118 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 341 | 2455283 | 2455468 | + | NC_020156.1 | Nonlabens dokdonensis DSW-6 |
| 342 | 1288894 | 1289043 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 343 | 344373 | 344525 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 344 | 1136505 | 1136654 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 345 | 3296406 | 3296555 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 346 | 1380508 | 1380657 | - | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 347 | 1423174 | 1423323 | - | NZ_AP018549.1 | Lactobacillus paragasseri |
| 348 | 50167 | 50325 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 349 | 1668630 | 1668803 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 350 | 527158 | 527346 | + | NZ_CP024728.1 | Prevotella intermedia |
| 351 | 2013541 | 2013702 | - | NZ_LR134384.1 | Prevotella oris |
| 352 | 3229036 | 3229197 | + | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 353 | 7422943 | 7423092 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 354 | 161868 | 162020 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 355 | 178378 | 178530 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 356 | 2026352 | 2026504 | - | NC_017448.1 | Fibrobacter succinogenes subsp. succinogenes S85 |
| 357 | 787633 | 787782 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 358 | 2735106 | 2735255 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 359 | 5420730 | 5420900 | - | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 360 | 2470091 | 2470255 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 361 | 616906 | 617061 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 362 | 3903724 | 3903873 | - | NZ_CP010777.1 | Rufibacter radiotolerans |
| 363 | 348082 | 348234 | + | NZ_LS991949.1 | Mycoplasma alkalescens |
| 364 | 1696839 | 1696997 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 365 | 727235 | 727384 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 366 | 224372 | 224524 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 367 | 1317294 | 1317452 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 368 | 1567722 | 1567871 | - | NZ_CP070062.1 | Coprococcus comes |
| 369 | 1604316 | 1604465 | - | NZ_CP012643.1 | Rufibacter tibetensis |
| 370 | 3245772 | 3245933 | + | NC_010162.1 | Sorangium cellulosum So ce56 |
| 371 | 1483200 | 1483349 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 372 | 337980 | 338129 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 373 | 5769275 | 5769424 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 374 | 1124957 | 1125106 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 375 | 2391403 | 2391552 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 376 | 4011697 | 4011846 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 377 | 128477 | 128629 | - | NZ_CP029258.1 | Mycoplasmopsis synoviae |
| 378 | 712833 | 712985 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
| 379 | 2679510 | 2679653 | - | NZ_HG917868.1 | Clostridium bornimense |
| 380 | 832498 | 832650 | + | NZ_CP011368.1 | Mycoplasmopsis canis |
| 381 | 4056856 | 4057023 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 382 | 643666 | 643809 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 383 | 504374 | 504532 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 384 | 3884630 | 3884782 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 385 | 2554443 | 2554616 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 386 | 2521047 | 2521190 | - | NZ_CP018799.1 | Mariprofundus aestuarium |
| 387 | 679313 | 679465 | - | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 388 | 2304735 | 2304887 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 389 | 1130025 | 1130174 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 390 | 287204 | 287356 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 391 | 689186 | 689338 | + | NZ_LR215039.1 | Mycoplasmopsis columboralis |
| 392 | 1769976 | 1770125 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 393 | 850409 | 850558 | - | NZ_CP055156.1 | Adhaeribacter swui |
| 394 | 2285216 | 2285359 | - | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 395 | 1173799 | 1173948 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 396 | 7158701 | 7158850 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 397 | 460412 | 460579 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 398 | 1579093 | 1579260 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 399 | 1195172 | 1195342 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 400 | 812042 | 812194 | - | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
| 401 | 1141599 | 1141763 | - | NZ_CP027226.1 | Fastidiosipila sanguinis |
| 402 | 445436 | 445585 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 403 | 53864 | 54016 | + | NZ_AP018940.1 | Mycoplasmopsis californica |
| 404 | 5249292 | 5249441 | - | NZ_AP017422.1 | Filimonas lacunae |
| 405 | 227484 | 227633 | - | NC_018010.1 | Belliella baltica DSM 15883 |
| 406 | 6457086 | 6457235 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 407 | 253871 | 254023 | - | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 408 | 1367818 | 1367967 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 409 | 5099146 | 5099295 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 410 | 894437 | 894586 | - | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 411 | 1151537 | 1151686 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 412 | 1487497 | 1487646 | + | NC_017045.1 | Riemerella anatipestifer ATCC 11845 = DSM 15868 |
| 413 | 332259 | 332411 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 414 | 679065 | 679214 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 415 | 2309451 | 2309618 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 416 | 2133019 | 2133186 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 417 | 468698 | 468841 | - | NZ_CP016211.1 | Minicystis rosea |
| 418 | 2681509 | 2681658 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 419 | 394443 | 394595 | - | NZ_LR215043.1 | Mycoplasmopsis columbinasalis |
| 420 | 3376912 | 3377067 | - | NZ_CP032157.1 | Paraflavitalea soli |
| 421 | 1391974 | 1392162 | + | NZ_CP069440.1 | Phocaeicola coprophilus |
| 422 | 4111123 | 4111311 | + | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 423 | 4519227 | 4519415 | + | NZ_LR699004.1 | Phocaeicola dorei |
| 424 | 265063 | 265224 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 425 | 940452 | 940601 | + | NZ_CP063145.1 | Cruoricaptor ignavus |
| 426 | 2490206 | 2490376 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 427 | 2842311 | 2842499 | - | NZ_CP015772.1 | Niabella ginsenosidivorans |
| 428 | 969758 | 969940 | - | NZ_AP019735.1 | Alistipes communis |
| 429 | 2054134 | 2054316 | - | NZ_LT906465.1 | Chryseobacterium taklimakanense |
| 430 | 582476 | 582664 | + | NZ_CP015402.2 | Muribaculum intestinale |
| 431 | 794900 | 795052 | - | NZ_AP022325.1 | Mycoplasmopsis felis |
| 432 | 497871 | 498014 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 433 | 491033 | 491176 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 434 | 1369875 | 1370024 | - | NC_016599.1 | Owenweeksia hongkongensis DSM 17368 |
| 435 | 2332177 | 2332344 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 436 | 1933432 | 1933620 | - | NZ_CP007035.1 | Niabella soli DSM 19437 |
| 437 | 266855 | 267007 | - | NZ_LR215032.1 | Mycoplasmopsis gallopavonis |
| 438 | 95387 | 95539 | - | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 439 | 1072968 | 1073135 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 440 | 4233226 | 4233393 | - | NZ_LS483422.1 | Providencia heimbachae |
| 441 | 843780 | 843947 | + | NZ_CP029736.1 | Providencia rettgeri |
| 442 | 3731412 | 3731579 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 443 | 578363 | 578515 | - | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 444 | 12708 | 12860 | - | NZ_AP014631.1 | Mycoplasma canadense |
| 445 | 408457 | 408609 | - | NZ_CP040825.1 | Mycoplasma nasistruthionis |
| 446 | 545118 | 545270 | - | NZ_LR215042.1 | Mycoplasmopsis meleagridis |
| 447 | 1146479 | 1146667 | + | NZ_LT608328.1 | Petrimonas mucosa |
| 448 | 1079812 | 1079967 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 449 | 1584979 | 1585128 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 450 | 235625 | 235774 | + | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 451 | 642612 | 642761 | + | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 452 | 2415526 | 2415696 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 453 | 4704692 | 4704847 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 454 | 2563046 | 2563189 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 455 | 458604 | 458759 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 456 | 2773742 | 2773897 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 457 | 1994304 | 1994459 | + | NZ_CP015401.2 | Bacteroides caecimuris |
| 458 | 2843272 | 2843427 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 459 | 914741 | 914896 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 460 | 1266640 | 1266789 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 461 | 2409270 | 2409452 | - | NC_014759.1 | Marivirga tractuosa DSM 4126 |
| 462 | 926771 | 926920 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 463 | 364912 | 365082 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 464 | 820040 | 820222 | + | NZ_CP049246.1 | Sphingobacterium lactis |
| 465 | 1774493 | 1774663 | - | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 466 | 3109738 | 3109893 | + | NZ_CP012040.1 | Cyclobacterium amurskyense |
| 467 | 3099813 | 3099968 | + | NC_015914.1 | Cyclobacterium marinum DSM 745 |
| 468 | 748387 | 748536 | + | NC_008255.1 | Cytophaga hutchinsonii ATCC 33406 |
| 469 | 3726145 | 3726327 | - | NZ_CP037755.1 | Pseudocnuella soli |
| 470 | 492276 | 492443 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 471 | 607392 | 607538 | - | NZ_LR214938.2 | Mycoplasma salivarium |
| 472 | 228671 | 228814 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 473 | 460964 | 461107 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 474 | 471072 | 471215 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 475 | 598515 | 598667 | + | NZ_CP034044.1 | Mycoplasma struthionis |
| 476 | 905060 | 905212 | + | NZ_LR214986.1 | Mycoplasmopsis cynos |
| 477 | 4511941 | 4512102 | - | NZ_CP007145.1 | Hymenobacter swuensis DY53 |
| 478 | 526529 | 526681 | + | NZ_LR215041.1 | Mycoplasmopsis columbina |
| 479 | 1224872 | 1225021 | - | NZ_CP042434.1 | Arachidicoccus ginsenosidivorans |
| 480 | 683739 | 683888 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 481 | 318407 | 318577 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 482 | 584489 | 584659 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 483 | 1318020 | 1318187 | - | NZ_CP059443.1 | Campylobacter fetus |
| 484 | 1466027 | 1466194 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 485 | 375426 | 375575 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 486 | 54061 | 54213 | - | NZ_CP030140.1 | Mycoplasma anseris |
| 487 | 261457 | 261609 | + | NZ_CP055143.1 | Mycoplasma hominis |
| 488 | 2605906 | 2606076 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 489 | 2128102 | 2128251 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 490 | 2191504 | 2191653 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 491 | 1501184 | 1501336 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 492 | 2137052 | 2137222 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 493 | 2262301 | 2262471 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 494 | 2115299 | 2115448 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 495 | 2895251 | 2895400 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 496 | 675949 | 676107 | + | NZ_CP012541.1 | Campylobacter concisus |
| 497 | 446976 | 447149 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 498 | 2061861 | 2062013 | - | NZ_CP063164.1 | Sulfurovum indicum |
| 499 | 235408 | 235560 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 500 | 1583766 | 1583915 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 501 | 448082 | 448249 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 502 | 472352 | 472501 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 503 | 5117570 | 5117719 | + | NZ_CP042806.1 | Terriglobus albidus |
| 504 | 393847 | 393990 | - | NZ_CP023668.1 | Mesoplasma lactucae ATCC 49193 |
| 505 | 1027703 | 1027855 | + | NZ_CP024161.1 | Mycoplasma dispar |
| 506 | 3385508 | 3385657 | + | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 507 | 1097820 | 1097969 | + | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 508 | 2624033 | 2624191 | - | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 509 | 3564044 | 3564193 | - | NZ_CP016757.1 | Cloacibacillus porcorum |
| 510 | 1953438 | 1953620 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 511 | 876653 | 876802 | + | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 512 | 1527697 | 1527846 | + | NZ_CP030840.1 | Acidisarcina polymorpha |
| 513 | 1290861 | 1291043 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
++ More..