Result : C0QVZ8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP001357.1 |
| Organism | Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) |
| Left | 2433886 |
| Right | 2434179 |
| Strand | + |
| Nucleotide Sequence | ATGTATTCACTTTTAATTGAGCCTATACTTACAGAAAAAAGTAATATGCTTAGAACTGAGCCTAGAGGAACAGAGAAGCGTTATTATGTATTTAAAGTAAGACAGGACGCTAATAAGACAGAATTAAAGAAAGCGGTTGAGAAAATATTTAATGTACATCCGCTAGATTGTAAGATAATAAATGTTAAGCCTAAGAAGAAAAATCGCAGAATGAGCAGACGCGGATATACACGCAGCTATAAAAAAGCGATAATAGTTCTTGACGGCAAAGAATCAATAGATATAGTAAAATAA |
| Sequence | MYSLLIEPILTEKSNMLRTEPRGTEKRYYVFKVRQDANKTELKKAVEKIFNVHPLDCKIINVKPKKKNRRMSRRGYTRSYKKAIIVLDGKESIDIVK |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 19262690 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C0QVZ8 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2245835 | 2246128 | + | NZ_CP046932.1 | Brachyspira hyodysenteriae |
| 2 | 2875730 | 2876023 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 3 | 2101994 | 2102287 | + | NC_014150.1 | Brachyspira murdochii DSM 12563 |
| 4 | 1289143 | 1289436 | - | NZ_CP019914.1 | Brachyspira hampsonii |
| 5 | 1130221 | 1130514 | - | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
| 6 | 1237131 | 1237436 | + | NC_011653.1 | Thermosipho africanus TCF52B |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP046932.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 1.0 | 6 | 2397.0 | same-strand | Elongation factor Tu GTP binding domain |
| 2 | PF03764.20 | 1.0 | 6 | 3132.0 | same-strand | Elongation factor G, domain IV |
| 3 | PF14492.8 | 1.0 | 6 | 3132.0 | same-strand | Elongation Factor G, domain III |
| 4 | PF00679.26 | 1.0 | 6 | 3132.0 | same-strand | Elongation factor G C-terminus |
| 5 | PF03144.27 | 1.0 | 6 | 2397.0 | same-strand | Elongation factor Tu domain 2 |
| 6 | PF03143.19 | 1.0 | 6 | 1833.0 | same-strand | Elongation factor Tu C-terminal domain |
| 7 | PF01926.25 | 1.0 | 6 | 1833 | same-strand | 50S ribosome-binding GTPase |
| 8 | PF00338.24 | 1.0 | 6 | 1446.0 | same-strand | Ribosomal protein S10p/S20e |
| 9 | PF00573.24 | 1.0 | 6 | 12.0 | same-strand | Ribosomal protein L4/L1 family |
| 10 | PF03947.20 | 1.0 | 6 | 13.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 11 | PF00181.25 | 1.0 | 6 | 13.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 12 | PF00203.23 | 1.0 | 6 | 849.5 | same-strand | Ribosomal protein S19 |
| 13 | PF00237.21 | 1.0 | 6 | 1130.5 | same-strand | Ribosomal protein L22p/L17e |
| 14 | PF00189.22 | 1.0 | 6 | 1541.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 15 | PF07650.19 | 1.0 | 6 | 1541.0 | same-strand | KH domain |
| 16 | PF00252.20 | 1.0 | 6 | 2278.0 | same-strand | Ribosomal protein L16p/L10e |
++ More..