Protein Information |
Information Type | Description |
---|---|
Protein name | Acyl carrier protein AsbD (Petrobactin biosynthesis protein AsbD) |
NCBI Accession ID | AE017334.2 |
Organism | Bacillus anthracis |
Left | 1869779 |
Right | 1870054 |
Strand | + |
Nucleotide Sequence | ATGAGACGGGAAGCGTTAAAGAATGCTGTATTAAAAATTATGACAGAAAAAATGGAACTGAAAAATGTAACGCATTTAGAAGAAACGATGCGTTTAAATCAAGATTTATATATTGATTCAGTAATGATGTTACAACTCATTGTATATATAGAAATGGATGTAAAGCTATGCGTTCCAGAGGATGAGGTAGACCCAAAAGCATTTCTTACTGTAGGATCTTTGCTTGATTTTATGGAGGAGTTGCAGCCGTTACAGGACGTAAATGTGAATAACTAA |
Sequence | MRREALKNAVLKIMTEKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDVKLCVPEDEVDPKAFLTVGSLLDFMEELQPLQDVNVNN |
Source of smORF | Swiss-Prot |
Function | Involved in the biosynthesis of petrobactin, a catecholate siderophore that functions in both iron acquisition and virulence (Pubmed:17189355, Pubmed:17346033). Aryl-carrier protein that activates 3,4-dihydroxybenzoate (3,4-DHBA) prior to its incorporation into petrobactin (Pubmed:17346033). {ECO:0000269|Pubmed:17189355, ECO:0000269|Pubmed:17346033}. |
Pubmed ID | 18952800 17189355 17346033 27425635 |
Domain | CDD:415812 |
Functional Category | Others |
Uniprot ID | A0A0J1I1I3 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1869779 | 1870054 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
2 | 1901131 | 1901406 | + | NC_011725.1 | Bacillus cereus B4264 |
3 | 1925128 | 1925403 | + | NZ_CP064875.1 | Bacillus toyonensis |
4 | 3210150 | 3210425 | - | NZ_CP040336.1 | Bacillus luti |
5 | 3076106 | 3076393 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
6 | 4029172 | 4029438 | - | NZ_LR134338.1 | Brevibacillus brevis |
7 | 7917947 | 7918231 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00583.27 | 0.71 | 5 | 5243 | same-strand | Acetyltransferase (GNAT) family |
2 | PF04183.14 | 1.0 | 7 | 1326 | same-strand | IucA / IucC family |
3 | PF06276.14 | 1.0 | 7 | 1326 | same-strand | Ferric iron reductase FhuF-like transporter |
4 | PF13193.8 | 1.0 | 7 | -3 | same-strand | AMP-binding enzyme C-terminal domain |
5 | PF19468.1 | 1.0 | 7 | 24 | same-strand | Family of unknown function (DUF6005) |
6 | PF01261.26 | 0.86 | 6 | 1045.0 | same-strand | Xylose isomerase-like TIM barrel |