Result : A0A0J1I1I3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acyl carrier protein AsbD (Petrobactin biosynthesis protein AsbD) |
| NCBI Accession ID | AE017334.2 |
| Organism | Bacillus anthracis |
| Left | 1869779 |
| Right | 1870054 |
| Strand | + |
| Nucleotide Sequence | ATGAGACGGGAAGCGTTAAAGAATGCTGTATTAAAAATTATGACAGAAAAAATGGAACTGAAAAATGTAACGCATTTAGAAGAAACGATGCGTTTAAATCAAGATTTATATATTGATTCAGTAATGATGTTACAACTCATTGTATATATAGAAATGGATGTAAAGCTATGCGTTCCAGAGGATGAGGTAGACCCAAAAGCATTTCTTACTGTAGGATCTTTGCTTGATTTTATGGAGGAGTTGCAGCCGTTACAGGACGTAAATGTGAATAACTAA |
| Sequence | MRREALKNAVLKIMTEKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDVKLCVPEDEVDPKAFLTVGSLLDFMEELQPLQDVNVNN |
| Source of smORF | Swiss-Prot |
| Function | Involved in the biosynthesis of petrobactin, a catecholate siderophore that functions in both iron acquisition and virulence (Pubmed:17189355, Pubmed:17346033). Aryl-carrier protein that activates 3,4-dihydroxybenzoate (3,4-DHBA) prior to its incorporation into petrobactin (Pubmed:17346033). {ECO:0000269|Pubmed:17189355, ECO:0000269|Pubmed:17346033}. |
| Pubmed ID | 18952800 17189355 17346033 27425635 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | A0A0J1I1I3 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1869779 | 1870054 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 2 | 1901131 | 1901406 | + | NC_011725.1 | Bacillus cereus B4264 |
| 3 | 1925128 | 1925403 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 4 | 3210150 | 3210425 | - | NZ_CP040336.1 | Bacillus luti |
| 5 | 3076106 | 3076393 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 6 | 4029172 | 4029438 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 7 | 7917947 | 7918231 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007530.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00583.27 | 0.71 | 5 | 5243 | same-strand | Acetyltransferase (GNAT) family |
| 2 | PF04183.14 | 1.0 | 7 | 1326 | same-strand | IucA / IucC family |
| 3 | PF06276.14 | 1.0 | 7 | 1326 | same-strand | Ferric iron reductase FhuF-like transporter |
| 4 | PF13193.8 | 1.0 | 7 | -3 | same-strand | AMP-binding enzyme C-terminal domain |
| 5 | PF19468.1 | 1.0 | 7 | 24 | same-strand | Family of unknown function (DUF6005) |
| 6 | PF01261.26 | 0.86 | 6 | 1045.0 | same-strand | Xylose isomerase-like TIM barrel |
++ More..