Result : C0QR95
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP001230.1 |
| Organism | Persephonella marina (strain DSM 14350 / EX-H1) |
| Left | 1339950 |
| Right | 1340156 |
| Strand | + |
| Nucleotide Sequence | TTGAATAAAAGACCTTTGATAGAACAGGCATTAAAAAGGGTTAACAACAGGTATGAGCTTGTTCACGCCGCAGCAAAACTTGCCAAGGATCTGTATGAAACTGGAGCGGAGAGCTACGTAACTGAAGAGGGAATCCCTTTAAAGAAGACTGTAATATCAATAAATGAGATAGCAAAAGGAAGAGCCGTTATACTCAGGAAGGAGTAG |
| Sequence | MNKRPLIEQALKRVNNRYELVHAAAKLAKDLYETGAESYVTEEGIPLKKTVISINEIAKGRAVILRKE |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 19136599 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | C0QR95 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1339950 | 1340156 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 2 | 249160 | 249375 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012440.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00361.22 | 1.0 | 2 | 2300.5 | same-strand | Proton-conducting membrane transporter |
| 2 | PF00662.22 | 1.0 | 2 | 3821.0 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
| 3 | PF00625.23 | 1.0 | 2 | 211.5 | same-strand | Guanylate kinase |
| 4 | PF00072.26 | 1.0 | 2 | 988.0 | both-strands | Response regulator receiver domain |
++ More..