Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | CP001230.1 |
Organism | Persephonella marina (strain DSM 14350 / EX-H1) |
Left | 1339950 |
Right | 1340156 |
Strand | + |
Nucleotide Sequence | TTGAATAAAAGACCTTTGATAGAACAGGCATTAAAAAGGGTTAACAACAGGTATGAGCTTGTTCACGCCGCAGCAAAACTTGCCAAGGATCTGTATGAAACTGGAGCGGAGAGCTACGTAACTGAAGAGGGAATCCCTTTAAAGAAGACTGTAATATCAATAAATGAGATAGCAAAAGGAAGAGCCGTTATACTCAGGAAGGAGTAG |
Sequence | MNKRPLIEQALKRVNNRYELVHAAAKLAKDLYETGAESYVTEEGIPLKKTVISINEIAKGRAVILRKE |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
Pubmed ID | 19136599 |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | C0QR95 |
ORF Length (Amino Acid) | 68 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1339950 | 1340156 | + | NC_012440.1 | Persephonella marina EX-H1 |
2 | 249160 | 249375 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00361.22 | 1.0 | 2 | 2300.5 | same-strand | Proton-conducting membrane transporter |
2 | PF00662.22 | 1.0 | 2 | 3821.0 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
3 | PF00625.23 | 1.0 | 2 | 211.5 | same-strand | Guanylate kinase |
4 | PF00072.26 | 1.0 | 2 | 988.0 | both-strands | Response regulator receiver domain |