Result : C0QR89
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) |
| NCBI Accession ID | CP001230.1 |
| Organism | Persephonella marina (strain DSM 14350 / EX-H1) |
| Left | 1333700 |
| Right | 1334002 |
| Strand | + |
| Nucleotide Sequence | ATGGTTCCTTACGAGTATTATGTTGTTTTAAGTGGTCTTCTAATGGTTCTCGGGCTTATAGGTATCATAATCAGGAAAAATCTTATAGCTATGCTTTTATCCACAGAGCTTATGCTTAACGCTGTAAATATTGCCTTCGTTGCCTTTGATATGAAACTTTACGATGTTTCAGGTCAGGTTTTTGTTTTCTTCATTCTTACAATAGCTGCAGCCGAAGCTGCTGTTGGTCTTGGTCTTATTATGGCTATTTACAGACTTAGAAAAGATGTTGATGTTAACACACTCACAGAACTAAAACTATAG |
| Sequence | MVPYEYYVVLSGLLMVLGLIGIIIRKNLIAMLLSTELMLNAVNIAFVAFDMKLYDVSGQVFVFFILTIAAAEAAVGLGLIMAIYRLRKDVDVNTLTELKL |
| Source of smORF | Swiss-Prot |
| Function | NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. {ECO:0000255|HAMAP-Rule:MF_01456}. |
| Pubmed ID | 19136599 |
| Domain | CDD:412408 |
| Functional Category | Others |
| Uniprot ID | C0QR89 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 83
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1333700 | 1334002 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 2 | 254980 | 255282 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 3 | 509122 | 509370 | - | NZ_CP011801.1 | Nitrospira moscoviensis |
| 4 | 565986 | 566288 | + | NZ_CP010028.1 | Deinococcus radiopugnans |
| 5 | 5938166 | 5938495 | + | NZ_CP060723.1 | Pedobacter roseus |
| 6 | 4212804 | 4213112 | - | NZ_CP024091.1 | Pedobacter ginsengisoli |
| 7 | 172558 | 172887 | - | NZ_CP042436.1 | Mucilaginibacter ginsenosidivorans |
| 8 | 2470608 | 2470913 | - | NZ_AP014936.1 | Sulfurifustis variabilis |
| 9 | 712907 | 713209 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 10 | 5727891 | 5728235 | - | NZ_CP010429.1 | Spirosoma radiotolerans |
| 11 | 2123933 | 2124238 | - | NZ_AP014879.1 | Sulfuricaulis limicola |
| 12 | 1596125 | 1596430 | + | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 13 | 601070 | 601372 | + | NC_012526.1 | Deinococcus deserti VCD115 |
| 14 | 6567639 | 6567983 | - | NZ_CP025096.1 | Spirosoma pollinicola |
| 15 | 1758108 | 1758452 | + | NZ_CP020105.1 | Spirosoma rigui |
| 16 | 933233 | 933535 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 17 | 979438 | 979707 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 18 | 4647850 | 4648194 | - | NZ_CP014263.1 | Spirosoma montaniterrae |
| 19 | 2411309 | 2411560 | - | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 20 | 13499 | 13843 | + | NZ_CP053435.1 | Spirosoma taeanense |
| 21 | 246062 | 246406 | - | NZ_CP050063.1 | Spirosoma aureum |
| 22 | 7388901 | 7389158 | - | NZ_CP020104.1 | Spirosoma aerolatum |
| 23 | 1522366 | 1522617 | + | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 24 | 965195 | 965506 | - | NZ_CP058334.1 | Natronomonas halophila |
| 25 | 450755 | 451018 | - | NZ_CP007028.1 | Thermocrinis ruber |
| 26 | 460289 | 460591 | - | NZ_CP007028.1 | Thermocrinis ruber |
| 27 | 3003344 | 3003649 | - | NZ_CP053073.1 | Usitatibacter palustris |
| 28 | 1914974 | 1915276 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 29 | 1122855 | 1123100 | + | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 30 | 1132334 | 1132579 | + | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 31 | 1549235 | 1549534 | - | NZ_LT828648.1 | Nitrospira japonica |
| 32 | 97669 | 97974 | - | NZ_LR134433.1 | Legionella adelaidensis |
| 33 | 2061088 | 2061369 | - | NC_010794.1 | Methylacidiphilum infernorum V4 |
| 34 | 3532569 | 3532820 | - | NZ_CP013729.1 | Roseateles depolymerans |
| 35 | 2265981 | 2266247 | - | NZ_CP040709.1 | Inhella inkyongensis |
| 36 | 957486 | 957737 | + | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 37 | 1247783 | 1248031 | - | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 38 | 2038547 | 2038798 | + | NZ_CP022423.1 | Vitreoscilla filiformis |
| 39 | 1226125 | 1226427 | + | NZ_CP011387.1 | Deinococcus puniceus |
| 40 | 948572 | 948877 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 41 | 1402251 | 1402502 | + | NZ_CP062147.1 | Komagataeibacter hansenii |
| 42 | 3846416 | 3846721 | - | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 43 | 2275152 | 2275403 | - | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 44 | 1317995 | 1318297 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 45 | 1536468 | 1536773 | + | NZ_CP011971.1 | Steroidobacter denitrificans |
| 46 | 117181 | 117465 | + | NZ_CP015136.1 | Luteitalea pratensis |
| 47 | 3729694 | 3729969 | - | NC_016609.1 | Niastella koreensis GR20-10 |
| 48 | 689237 | 689542 | - | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 49 | 2031450 | 2031755 | - | NZ_LR134374.1 | Legionella spiritensis |
| 50 | 320974 | 321279 | + | NC_013861.1 | Legionella longbeachae NSW150 |
| 51 | 4082511 | 4082816 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 52 | 1912784 | 1913089 | - | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 53 | 2133122 | 2133403 | + | NZ_CP044285.1 | Hymenobacter baengnokdamensis |
| 54 | 876335 | 876640 | - | NZ_CP011451.1 | Nitrosomonas communis |
| 55 | 1340234 | 1340539 | + | NZ_AP012273.1 | Thiolapillus brandeum |
| 56 | 632430 | 632735 | - | NZ_AP019755.1 | Nitrosomonas stercoris |
| 57 | 3465805 | 3466110 | - | NZ_LT906442.1 | Legionella waltersii |
| 58 | 3243485 | 3243742 | - | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 59 | 958028 | 958333 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 60 | 408792 | 409073 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 61 | 260506 | 260757 | + | NZ_CP025120.1 | Kangiella profundi |
| 62 | 310883 | 311131 | + | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 63 | 2272687 | 2272938 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 64 | 2263447 | 2263713 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 65 | 3142140 | 3142445 | - | NZ_CP013742.1 | Legionella pneumophila |
| 66 | 918546 | 918851 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 67 | 1801992 | 1802237 | - | NZ_CP063145.1 | Cruoricaptor ignavus |
| 68 | 2307589 | 2307894 | - | NC_014394.1 | Gallionella capsiferriformans ES-2 |
| 69 | 1219437 | 1219715 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
| 70 | 2230882 | 2231187 | - | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 71 | 1075686 | 1075991 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 72 | 2742569 | 2742874 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 73 | 932479 | 932724 | - | NC_017045.1 | Riemerella anatipestifer ATCC 11845 = DSM 15868 |
| 74 | 2861574 | 2861834 | + | NZ_CP024920.1 | Qipengyuania seohaensis |
| 75 | 2181382 | 2181690 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 76 | 4034861 | 4035169 | - | NZ_CP044331.1 | Methylocystis parvus |
| 77 | 1056699 | 1056947 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 78 | 2927272 | 2927520 | - | NZ_CP027792.1 | Pulveribacter suum |
| 79 | 413396 | 413644 | + | NC_015510.1 | Haliscomenobacter hydrossis DSM 1100 |
| 80 | 528651 | 528902 | + | NZ_LR699119.1 | Aquicella siphonis |
| 81 | 5975541 | 5975810 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 82 | 1668720 | 1668998 | - | NZ_LR699114.1 | Aquicella lusitana |
| 83 | 790437 | 790742 | + | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 84 | 1272388 | 1272693 | - | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 85 | 214707 | 214949 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 86 | 5413857 | 5414126 | + | NZ_CP012159.1 | Chondromyces crocatus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011801.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00146.23 | 0.84 | 70 | 1202.5 | same-strand | NADH dehydrogenase |
| 2 | PF13237.8 | 0.87 | 72 | 687.5 | same-strand | 4Fe-4S dicluster domain |
| 3 | PF12838.9 | 0.87 | 72 | 687.5 | same-strand | 4Fe-4S dicluster domain |
| 4 | PF13187.8 | 0.86 | 71 | 689 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF00499.22 | 0.89 | 74 | 26 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 6 |
| 6 | PF00361.22 | 1.0 | 83 | 2023.0 | same-strand | Proton-conducting membrane transporter |
| 7 | PF00662.22 | 0.96 | 80 | 7.5 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
| 8 | PF00037.29 | 0.81 | 67 | 690 | same-strand | 4Fe-4S binding domain |
| 9 | PF13510.8 | 0.75 | 62 | 2289.5 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 10 | PF10588.11 | 0.76 | 63 | 2289 | same-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
| 11 | PF00111.29 | 0.7 | 58 | 2289.5 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 12 | PF01512.19 | 0.75 | 62 | 4609.5 | same-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
| 13 | PF10589.11 | 0.75 | 62 | 4609.5 | same-strand | NADH-ubiquinone oxidoreductase-F iron-sulfur binding region |
| 14 | PF10531.11 | 0.71 | 59 | 4616 | same-strand | SLBB domain |
++ More..