Result : C0QQP1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | CP001230.1 |
| Organism | Persephonella marina (strain DSM 14350 / EX-H1) |
| Left | 1149946 |
| Right | 1150125 |
| Strand | + |
| Nucleotide Sequence | ATGAGAATAAAGGTTAAACTTGTAAGAGGACTCGCTGGAAAGAGAAAGGATCAGATAAAGGCTGTCAGATCACTTGGGCTTAAGAAGGTTAATGATGAGAGAATCTTAGAGAAAAATCCTATGGTTCTTGGAAATATAAATAAAGTTAAACACCTGATACAAGTGGAGGAAGTAGAGTAA |
| Sequence | MRIKVKLVRGLAGKRKDQIKAVRSLGLKKVNDERILEKNPMVLGNINKVKHLIQVEEVE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 19136599 |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C0QQP1 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1149946 | 1150125 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 2 | 1613962 | 1614141 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 3 | 275992 | 276153 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 4 | 670281 | 670469 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 5 | 714459 | 714644 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 6 | 1582584 | 1582742 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 7 | 1558015 | 1558173 | - | NZ_CP038452.1 | Thermus caldilimi |
| 8 | 266327 | 266485 | + | NC_019386.1 | Thermus oshimai JL-2 |
| 9 | 417519 | 417677 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 10 | 327782 | 327949 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 11 | 525558 | 525725 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 12 | 983635 | 983802 | + | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 13 | 881264 | 881416 | + | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 14 | 816268 | 816435 | - | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 15 | 141926 | 142105 | + | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 16 | 159277 | 159456 | + | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 17 | 181198 | 181377 | + | NZ_CP037993.1 | Herbaspirillum huttiense |
| 18 | 3770124 | 3770291 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 19 | 616173 | 616373 | + | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 20 | 1566568 | 1566729 | + | NZ_AP014940.1 | Lysobacter enzymogenes |
| 21 | 3408390 | 3408569 | - | NZ_CP018845.1 | Herbaspirillum robiniae |
| 22 | 1163474 | 1163632 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 23 | 928752 | 928943 | + | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 24 | 340501 | 340668 | + | NZ_CP029556.1 | Lysobacter oculi |
| 25 | 2681680 | 2681841 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
| 26 | 4270760 | 4270936 | + | NZ_CP046904.1 | Massilia flava |
| 27 | 5417058 | 5417210 | + | NZ_CP040017.1 | Massilia umbonata |
| 28 | 6460146 | 6460298 | - | NZ_CP036401.1 | Massilia albidiflava |
| 29 | 903083 | 903250 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 30 | 902492 | 902659 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 31 | 4114389 | 4114541 | + | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 32 | 1158080 | 1158247 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 33 | 1187567 | 1187734 | + | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 34 | 3129677 | 3129844 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 35 | 1289911 | 1290096 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
| 36 | 2864751 | 2864912 | - | NZ_CP029843.1 | Lysobacter maris |
| 37 | 6035315 | 6035467 | - | NZ_CP028324.1 | Massilia armeniaca |
| 38 | 2741060 | 2741239 | - | NZ_CP041345.1 | Tenuifilum thalassicum |
| 39 | 1154416 | 1154583 | + | NZ_CP048044.1 | Xanthomonas citri |
| 40 | 1534228 | 1534410 | - | NC_015389.1 | Coriobacterium glomerans PW2 |
| 41 | 394523 | 394702 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 42 | 1343049 | 1343225 | - | NZ_LR134506.1 | Porphyromonas cangingivalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP046570.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 1.0 | 42 | 1988.0 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00410.21 | 1.0 | 42 | 1541.0 | same-strand | Ribosomal protein S8 |
| 3 | PF00347.25 | 1.0 | 42 | 979.0 | same-strand | Ribosomal protein L6 |
| 4 | PF00861.24 | 1.0 | 42 | 593.0 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 5 | PF03719.17 | 1.0 | 42 | 17.0 | same-strand | Ribosomal protein S5, C-terminal domain |
| 6 | PF00333.22 | 1.0 | 42 | 17.0 | same-strand | Ribosomal protein S5, N-terminal domain |
| 7 | PF00828.21 | 1.0 | 42 | 5.5 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 8 | PF00344.22 | 1.0 | 42 | 457.5 | same-strand | SecY |
| 9 | PF00416.24 | 0.62 | 26 | 2169.5 | same-strand | Ribosomal protein S13/S18 |
++ More..