Result : C0QM36
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CP001087.1 |
| Organism | Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) |
| Left | 1394683 |
| Right | 1394907 |
| Strand | - |
| Nucleotide Sequence | ATGTCCAAGGAATGCAAGATATGCGGAAAAAAACCCATGGTTGGAAACAATGTCAGCCATGCACACAATGTTAACAAAAGAAGGTTCAACCCCAACCTTCAGCGGGTAAAGGCCCTTTTTGATGGCCAGGTAAGACGTATCGATGTATGCACAAGCTGCATCAAGGCCGGCAAGGTAGTCAAGGCCCCGACCATGGGCCAGGGAAAGGTCACCAGCGCTTCCTAA |
| Sequence | MSKECKICGKKPMVGNNVSHAHNVNKRRFNPNLQRVKALFDGQVRRIDVCTSCIKAGKVVKAPTMGQGKVTSAS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19187283 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C0QM36 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 257
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1394683 | 1394907 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 2 | 395950 | 396141 | - | NZ_CP061800.1 | Desulfonema magnum |
| 3 | 4129354 | 4129545 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 4 | 84611 | 84805 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 5 | 5655213 | 5655404 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 6 | 1353011 | 1353202 | + | NZ_CP061799.1 | Desulfonema limicola |
| 7 | 3137974 | 3138165 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 8 | 3400021 | 3400212 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 9 | 2506165 | 2506356 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 10 | 590425 | 590613 | + | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 11 | 127051 | 127239 | - | NZ_CP042806.1 | Terriglobus albidus |
| 12 | 1474432 | 1474641 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 13 | 2259177 | 2259371 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 14 | 1149930 | 1150121 | - | NZ_CP018799.1 | Mariprofundus aestuarium |
| 15 | 1229619 | 1229810 | + | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 16 | 6894698 | 6894889 | + | NZ_CP015136.1 | Luteitalea pratensis |
| 17 | 2986008 | 2986229 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 18 | 1394517 | 1394708 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 19 | 515443 | 515655 | - | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 20 | 2530059 | 2530250 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 21 | 1383459 | 1383650 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 22 | 1396935 | 1397135 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 23 | 1642582 | 1642779 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 24 | 1524820 | 1525011 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 25 | 4079088 | 4079276 | + | NZ_CP030840.1 | Acidisarcina polymorpha |
| 26 | 1437234 | 1437443 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 27 | 5419634 | 5419825 | + | NZ_CP012109.1 | Myxococcus hansupus |
| 28 | 2960011 | 2960202 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 29 | 2055762 | 2055953 | - | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 30 | 1789531 | 1789722 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 31 | 2327689 | 2327883 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 32 | 3217293 | 3217499 | + | NZ_CP036250.1 | Egicoccus halophilus |
| 33 | 1510522 | 1510713 | - | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 34 | 1843116 | 1843313 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 35 | 210188 | 210385 | + | NZ_CP021255.1 | Desulfobulbus oralis |
| 36 | 2370058 | 2370267 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 37 | 3146240 | 3146431 | - | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 38 | 2726838 | 2727026 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 39 | 93627 | 93827 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 40 | 6725459 | 6725650 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 41 | 1568009 | 1568200 | + | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 42 | 4200533 | 4200724 | + | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 43 | 2591419 | 2591607 | + | NC_014830.1 | Intrasporangium calvum DSM 43043 |
| 44 | 3928090 | 3928281 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 45 | 3146723 | 3146914 | - | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 46 | 2296892 | 2297083 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 47 | 2382681 | 2382872 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 48 | 3406436 | 3406627 | - | NZ_CP021434.1 | Tumebacillus avium |
| 49 | 1293914 | 1294099 | - | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 50 | 694167 | 694361 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 51 | 591229 | 591420 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 52 | 922055 | 922249 | + | NC_015318.1 | Hippea maritima DSM 10411 |
| 53 | 521886 | 522074 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 54 | 290288 | 290476 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 55 | 323349 | 323540 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 56 | 721284 | 721496 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 57 | 3729871 | 3730062 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 58 | 1366684 | 1366878 | - | NZ_CP045851.1 | Actinomarinicola tropica |
| 59 | 5095063 | 5095248 | - | NZ_CP041146.1 | Nocardioides humi |
| 60 | 2466617 | 2466808 | + | NC_013530.1 | Xylanimonas cellulosilytica DSM 15894 |
| 61 | 2218127 | 2218312 | + | NZ_CP023692.1 | Streptomyces vinaceus |
| 62 | 530935 | 531126 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 63 | 2449918 | 2450109 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 64 | 1195526 | 1195711 | - | NZ_CP045737.1 | Aeromicrobium yanjiei |
| 65 | 3038123 | 3038308 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 66 | 1396902 | 1397087 | - | NZ_CP030862.1 | Streptomyces globosus |
| 67 | 1372361 | 1372549 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 68 | 2631537 | 2631728 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 69 | 5710884 | 5711069 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 70 | 6643681 | 6643866 | - | NZ_CP022685.1 | Streptomyces formicae |
| 71 | 3061509 | 3061694 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 72 | 315048 | 315236 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 73 | 457448 | 457639 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 74 | 4770317 | 4770502 | - | NZ_CP054938.1 | Streptomyces harbinensis |
| 75 | 4671955 | 4672140 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
| 76 | 6740455 | 6740640 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 77 | 923699 | 923896 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 78 | 1025625 | 1025834 | - | NC_020127.1 | Lawsonia intracellularis N343 |
| 79 | 3249090 | 3249281 | + | NZ_CP041694.1 | Cellulosimicrobium cellulans |
| 80 | 2959362 | 2959547 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 81 | 1017872 | 1018063 | - | NZ_CP033325.1 | Georgenia faecalis |
| 82 | 6348770 | 6348955 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 83 | 2074614 | 2074811 | + | NC_014246.1 | Mobiluncus curtisii ATCC 43063 |
| 84 | 5448150 | 5448335 | - | NZ_CP023693.1 | Streptomyces cinereoruber |
| 85 | 756705 | 756896 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 86 | 3019090 | 3019275 | + | NC_013929.1 | Streptomyces scabiei 87.22 |
| 87 | 3732350 | 3732535 | + | NZ_CP009896.1 | Pimelobacter simplex |
| 88 | 3578334 | 3578519 | + | NZ_CP022295.1 | Nocardioides aromaticivorans |
| 89 | 1812845 | 1813036 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 90 | 1884609 | 1884794 | + | NZ_CP048882.1 | Streptomyces bathyalis |
| 91 | 1176413 | 1176604 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 92 | 3699566 | 3699757 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 93 | 5364040 | 5364225 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 94 | 5841343 | 5841528 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 95 | 5584811 | 5584996 | - | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 96 | 2271767 | 2271952 | + | NZ_CP022310.1 | Streptomyces calvus |
| 97 | 2572251 | 2572436 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 98 | 6015956 | 6016141 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 99 | 2815077 | 2815262 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 100 | 6605788 | 6605973 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 101 | 3069884 | 3070069 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 102 | 7943860 | 7944045 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 103 | 7634474 | 7634659 | - | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 104 | 7367716 | 7367901 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 105 | 7180840 | 7181025 | - | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 106 | 2329441 | 2329632 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 107 | 1519730 | 1519921 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 108 | 1335333 | 1335524 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 109 | 4482923 | 4483108 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 110 | 5433798 | 5433983 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 111 | 5367710 | 5367895 | - | NZ_CP029043.1 | Streptomyces nigra |
| 112 | 5649434 | 5649619 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 113 | 6199638 | 6199823 | - | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 114 | 2738369 | 2738554 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 115 | 3283164 | 3283349 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 116 | 6390075 | 6390260 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 117 | 6620101 | 6620286 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 118 | 1495687 | 1495872 | + | NC_020990.1 | Streptomyces albidoflavus |
| 119 | 1874723 | 1874908 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 120 | 2714694 | 2714885 | + | NC_015514.1 | Cellulomonas fimi ATCC 484 |
| 121 | 1445310 | 1445501 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 122 | 656825 | 657016 | - | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 123 | 4976326 | 4976511 | - | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 124 | 2705666 | 2705851 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 125 | 6269978 | 6270163 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 126 | 1093601 | 1093786 | - | NZ_CP049257.1 | Nocardioides anomalus |
| 127 | 5192162 | 5192347 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 128 | 5388546 | 5388731 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 129 | 5531952 | 5532137 | - | NZ_CP029196.1 | Streptomyces venezuelae |
| 130 | 2581635 | 2581829 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 131 | 430164 | 430376 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 132 | 2595584 | 2595775 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 133 | 1282007 | 1282195 | + | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 134 | 2615176 | 2615379 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 135 | 789975 | 790184 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 136 | 1815415 | 1815627 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 137 | 5827510 | 5827695 | - | NZ_CP031194.1 | Streptomyces paludis |
| 138 | 3245726 | 3245917 | + | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
| 139 | 388766 | 388966 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 140 | 2135153 | 2135344 | + | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 141 | 716113 | 716304 | - | NZ_CP009302.1 | Berryella intestinalis |
| 142 | 2443775 | 2443969 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 143 | 67925 | 68119 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 144 | 614068 | 614265 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 145 | 2582491 | 2582676 | - | NZ_LR134442.1 | Propionibacterium australiense |
| 146 | 5290158 | 5290343 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 147 | 680094 | 680306 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 148 | 1411440 | 1411637 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 149 | 617399 | 617605 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 150 | 4515650 | 4515856 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 151 | 1723106 | 1723303 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 152 | 1758161 | 1758358 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 153 | 4011924 | 4012118 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 154 | 2859890 | 2860084 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 155 | 2859120 | 2859311 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 156 | 1846451 | 1846666 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 157 | 4458691 | 4458885 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 158 | 6692422 | 6692607 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 159 | 1094020 | 1094211 | + | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 160 | 1618180 | 1618371 | - | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 161 | 1011008 | 1011199 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 162 | 575850 | 576047 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 163 | 8842384 | 8842575 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 164 | 2447280 | 2447489 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 165 | 1311653 | 1311841 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 166 | 2762051 | 2762266 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 167 | 6294779 | 6294967 | + | NC_008278.1 | Frankia alni ACN14a |
| 168 | 916606 | 916818 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 169 | 3937136 | 3937324 | - | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 170 | 269708 | 269899 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 171 | 1345495 | 1345716 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 172 | 678002 | 678214 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 173 | 3046959 | 3047150 | + | NZ_CP042430.1 | Baekduia soli |
| 174 | 1584701 | 1584889 | + | NC_013124.1 | Acidimicrobium ferrooxidans DSM 10331 |
| 175 | 9254051 | 9254236 | + | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 176 | 1884862 | 1885056 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 177 | 3083832 | 3084020 | + | NC_014624.2 | Eubacterium callanderi |
| 178 | 1355825 | 1356013 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 179 | 3628791 | 3629000 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 180 | 1983993 | 1984184 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 181 | 5205514 | 5205708 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 182 | 2162608 | 2162796 | - | NZ_CP019962.1 | Eubacterium limosum |
| 183 | 1005839 | 1006033 | - | NZ_CP013290.1 | Janibacter indicus |
| 184 | 1304751 | 1304960 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 185 | 382962 | 383156 | + | NZ_AP012326.1 | Bifidobacterium dentium JCM 1195 = DSM 20436 |
| 186 | 1129980 | 1130171 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 187 | 242257 | 242454 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 188 | 2937586 | 2937777 | + | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 189 | 4347103 | 4347294 | + | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 190 | 786207 | 786398 | - | NZ_LT821227.1 | Phoenicibacter congonensis |
| 191 | 1187869 | 1188060 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 192 | 5318037 | 5318231 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 193 | 580664 | 580855 | - | NZ_CP009498.1 | Endomicrobium proavitum |
| 194 | 426032 | 426226 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 195 | 1559822 | 1560010 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 196 | 2973280 | 2973468 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 197 | 2009884 | 2010084 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 198 | 2273276 | 2273467 | - | NZ_AP023396.1 | Nocardia wallacei |
| 199 | 1381423 | 1381617 | + | NZ_CP044548.2 | Janibacter melonis |
| 200 | 2488385 | 2488579 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 201 | 3440892 | 3441086 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 202 | 2072091 | 2072282 | - | NZ_CP029146.1 | Rhodococcus ruber |
| 203 | 5755575 | 5755766 | + | NZ_LR134352.1 | Nocardia asteroides |
| 204 | 4871441 | 4871632 | + | NZ_CP018082.1 | Nocardia mangyaensis |
| 205 | 4838869 | 4839060 | + | NZ_CP041695.1 | Nocardia otitidiscaviarum |
| 206 | 3238715 | 3238906 | + | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 207 | 2550460 | 2550654 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 208 | 1012236 | 1012430 | - | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 209 | 2119133 | 2119327 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 210 | 4362491 | 4362685 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 211 | 3023339 | 3023536 | + | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 212 | 3636426 | 3636620 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 213 | 3623828 | 3624019 | - | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 214 | 3035497 | 3035709 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 215 | 3315522 | 3315716 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 216 | 4714809 | 4714994 | - | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 217 | 4062347 | 4062544 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 218 | 4947002 | 4947196 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 219 | 5643442 | 5643636 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 220 | 2263333 | 2263524 | - | NZ_AP017900.1 | Nocardia seriolae |
| 221 | 2530773 | 2530964 | + | NZ_CP048813.1 | Rhodococcus triatomae |
| 222 | 4551528 | 4551722 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 223 | 606344 | 606538 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 224 | 2441800 | 2441991 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 225 | 2035275 | 2035466 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 226 | 1792707 | 1792901 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 227 | 1325255 | 1325443 | - | NC_014666.1 | Frankia inefficax |
| 228 | 3096161 | 3096358 | + | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 229 | 3228204 | 3228401 | + | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 230 | 3289385 | 3289582 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 231 | 3326828 | 3327025 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 232 | 3525205 | 3525402 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 233 | 2172400 | 2172594 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 234 | 3722952 | 3723146 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 235 | 2406914 | 2407105 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 236 | 1552813 | 1553007 | + | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 237 | 764391 | 764585 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 238 | 2213134 | 2213328 | - | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 239 | 1675601 | 1675798 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 240 | 3009524 | 3009715 | + | NZ_CP011853.1 | Gordonia phthalatica |
| 241 | 1191438 | 1191632 | - | NZ_LT906453.1 | Dermatophilus congolensis |
| 242 | 376605 | 376796 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 243 | 881915 | 882109 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 244 | 126608 | 126802 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 245 | 3876218 | 3876409 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 246 | 3993744 | 3993935 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 247 | 2073714 | 2073908 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 248 | 3185062 | 3185256 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 249 | 505554 | 505748 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 250 | 2773017 | 2773208 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 251 | 2325919 | 2326110 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 252 | 3122061 | 3122255 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 253 | 2503137 | 2503325 | - | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
| 254 | 3290355 | 3290546 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 255 | 4078588 | 4078779 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 256 | 2234165 | 2234356 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 257 | 2441646 | 2441867 | - | NZ_CP011454.1 | Gemmatimonas phototrophica |
++ More..