Result : C0QKZ6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP001087.1 |
| Organism | Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) |
| Left | 3571294 |
| Right | 3571581 |
| Strand | - |
| Nucleotide Sequence | ATGAAGATTTCAAAGCAGGATGTGGAGCATCTGGCCCACCTGGCCCGTCTGGCTGTGGATGGGTCCCAGGTCGAAAGTCTTACGGCCCAGGTGAGCAATATCCTTGACTATATGGATGTATTAAAAGAGGTTGATGTGGATGGGGTGCCCCTTGCTTCGGGTGCGGCCCTTGGGACAAATGTTTTCAGGCAGGACCAGGTAAAACCCTCCCCGGGGCCTTGCGTCACCCTTGCCAATGCGCCCGAGCGGGACGATGATTTTTACACGGTTCCCAGGATTGTGGGATAG |
| Sequence | MKISKQDVEHLAHLARLAVDGSQVESLTAQVSNILDYMDVLKEVDVDGVPLASGAALGTNVFRQDQVKPSPGPCVTLANAPERDDDFYTVPRIVG |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 19187283 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | C0QKZ6 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3571294 | 3571581 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 2 | 3971544 | 3971831 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 3 | 3921775 | 3922059 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012108.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08676.13 | 1.0 | 3 | 1696 | same-strand | MutL C terminal dimerisation domain |
| 2 | PF01119.21 | 1.0 | 3 | 1696 | same-strand | DNA mismatch repair protein, C-terminal domain |
| 3 | PF01425.23 | 1.0 | 3 | 33 | same-strand | Amidase |
| 4 | PF05036.15 | 1.0 | 3 | 16 | same-strand | SPOR domain |
| 5 | PF05746.17 | 1.0 | 3 | 748 | same-strand | DALR anticodon binding domain |
| 6 | PF00750.21 | 1.0 | 3 | 748 | same-strand | tRNA synthetases class I (R) |
| 7 | PF03485.18 | 1.0 | 3 | 748 | same-strand | Arginyl tRNA synthetase N terminal domain |
++ More..