Result : C0QKM9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP001087.1 |
| Organism | Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) |
| Left | 3455035 |
| Right | 3455241 |
| Strand | - |
| Nucleotide Sequence | TTGGCAAGAGTAACCATTGAAGACTGTTTGAAAAATGTACCCAGCCGGTTTGCCCTGGTACACATGGCGGCCCTGCGGGTTCGCCAGCTCCGGGAAGGCGCTGATCTGCTCATTAAACCTTCTAAAAACGAAGATGCCGTCATAGCGTTGAGGGAGATTGCCGCCAACCGGATTGTACTGAAAAATAAATCCGACAAAAAAGGGTAG |
| Sequence | MARVTIEDCLKNVPSRFALVHMAALRVRQLREGADLLIKPSKNEDAVIALREIAANRIVLKNKSDKKG |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 19187283 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | C0QKM9 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 128
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3455035 | 3455241 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 2 | 1608997 | 1609200 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 3 | 567442 | 567642 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 4 | 1255542 | 1255742 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 5 | 1647302 | 1647508 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 6 | 168212 | 168412 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 7 | 4872809 | 4873015 | - | NZ_CP061799.1 | Desulfonema limicola |
| 8 | 489131 | 489334 | + | NZ_CP061800.1 | Desulfonema magnum |
| 9 | 159611 | 159823 | - | NC_016620.1 | Halobacteriovorax marinus SJ |
| 10 | 2617121 | 2617327 | - | NZ_AP018738.1 | Ferriphaselus amnicola |
| 11 | 2446796 | 2447002 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 12 | 406787 | 406993 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 13 | 711741 | 711968 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 14 | 859818 | 860027 | - | NC_020127.1 | Lawsonia intracellularis N343 |
| 15 | 143222 | 143434 | + | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
| 16 | 10318436 | 10318675 | - | NZ_CP012159.1 | Chondromyces crocatus |
| 17 | 2873291 | 2873530 | + | NZ_CP030032.1 | Bradymonas sediminis |
| 18 | 9616049 | 9616288 | + | NZ_CP016211.1 | Minicystis rosea |
| 19 | 1973582 | 1973800 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 20 | 2598502 | 2598714 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 21 | 2582962 | 2583165 | + | NZ_CP019038.1 | Massilia putida |
| 22 | 3708381 | 3708593 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 23 | 1843969 | 1844175 | + | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 24 | 5186605 | 5186808 | + | NZ_CP028324.1 | Massilia armeniaca |
| 25 | 1183425 | 1183628 | + | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 26 | 2777042 | 2777257 | - | NZ_CP029331.1 | Thauera hydrothermalis |
| 27 | 739226 | 739444 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 28 | 665733 | 665942 | + | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 29 | 107017 | 107229 | + | NC_014207.1 | Methylotenera versatilis 301 |
| 30 | 1638997 | 1639200 | + | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
| 31 | 2219484 | 2219690 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 32 | 3982036 | 3982239 | + | NZ_CP060783.1 | Diaphorobacter aerolatus |
| 33 | 1191988 | 1192191 | + | NZ_CP060714.1 | Diaphorobacter ruginosibacter |
| 34 | 854713 | 854916 | - | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 35 | 2036916 | 2037131 | + | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 36 | 1093992 | 1094195 | - | NZ_CP036401.1 | Massilia albidiflava |
| 37 | 3420841 | 3421053 | - | NZ_CP043869.1 | Neptunomonas concharum |
| 38 | 1227633 | 1227836 | - | NZ_CP031467.1 | Paraburkholderia caffeinilytica |
| 39 | 3384879 | 3385082 | + | NZ_CP040017.1 | Massilia umbonata |
| 40 | 2945821 | 2946024 | - | NZ_CP027792.1 | Pulveribacter suum |
| 41 | 499279 | 499491 | + | NZ_CP031093.1 | Hydrocarboniclastica marina |
| 42 | 2487054 | 2487257 | - | NZ_CP013236.1 | Collimonas pratensis |
| 43 | 3229471 | 3229674 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 44 | 1173444 | 1173650 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 45 | 2293507 | 2293710 | - | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 46 | 2634443 | 2634652 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 47 | 2763497 | 2763709 | - | NZ_CP017715.1 | Marinobacter salinus |
| 48 | 2936714 | 2936917 | + | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 49 | 1691845 | 1692048 | - | NZ_CP040709.1 | Inhella inkyongensis |
| 50 | 3328765 | 3328968 | - | NZ_CP024608.1 | Massilia violaceinigra |
| 51 | 1141291 | 1141494 | + | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 52 | 1507261 | 1507467 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 53 | 3732956 | 3733165 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 54 | 1394753 | 1394956 | - | NZ_HG322949.1 | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
| 55 | 5214028 | 5214231 | + | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 56 | 2872156 | 2872359 | + | NZ_CP041185.1 | Janthinobacterium tructae |
| 57 | 5277687 | 5277890 | + | NZ_CP048832.1 | Janthinobacterium lividum |
| 58 | 4337995 | 4338198 | + | NZ_CP043575.1 | Comamonas koreensis |
| 59 | 2091660 | 2091863 | - | NZ_CP013235.1 | Collimonas arenae |
| 60 | 2187465 | 2187665 | + | NZ_CP068055.1 | Sutterella wadsworthensis |
| 61 | 2961938 | 2962153 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 62 | 649508 | 649720 | + | NZ_CP011494.1 | Marinobacter psychrophilus |
| 63 | 701941 | 702144 | - | NZ_CP051461.1 | Polaromonas vacuolata |
| 64 | 2379475 | 2379684 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 65 | 924054 | 924257 | - | NZ_CP019239.1 | Rhodoferax saidenbachensis |
| 66 | 1283159 | 1283362 | - | NZ_CP035503.1 | Rhodoferax sediminis |
| 67 | 802535 | 802738 | + | NC_021287.1 | Caballeronia insecticola |
| 68 | 2348126 | 2348329 | - | NZ_CP009795.1 | Burkholderia dolosa AU0158 |
| 69 | 1384220 | 1384423 | + | NZ_CP009727.1 | Burkholderia mallei |
| 70 | 755495 | 755698 | + | NC_010622.1 | Paraburkholderia phymatum STM815 |
| 71 | 1021917 | 1022120 | + | NZ_CP013398.1 | Burkholderia seminalis |
| 72 | 3121707 | 3121910 | + | NZ_CP035900.1 | Burkholderia glumae |
| 73 | 1025764 | 1025967 | + | NZ_CP013401.1 | Burkholderia metallica |
| 74 | 2295508 | 2295711 | + | NZ_CP011503.1 | Burkholderia pyrrocinia |
| 75 | 1031172 | 1031375 | + | NZ_CP013450.1 | Burkholderia cenocepacia |
| 76 | 786985 | 787188 | + | NZ_CP026111.1 | Paraburkholderia terrae |
| 77 | 1205721 | 1205924 | - | NZ_CP015958.1 | Paraburkholderia caribensis |
| 78 | 1023520 | 1023723 | + | NZ_CP045235.1 | Burkholderia cepacia |
| 79 | 1036578 | 1036781 | + | NC_007510.1 | Burkholderia lata |
| 80 | 1058667 | 1058870 | + | NZ_CP020737.1 | Paraburkholderia acidophila |
| 81 | 3582669 | 3582872 | + | NZ_CP066075.1 | Paraburkholderia ginsengisoli |
| 82 | 2777662 | 2777865 | + | NZ_CP008781.1 | Burkholderia pseudomallei |
| 83 | 3114996 | 3115199 | - | NZ_CP024934.1 | Paraburkholderia graminis |
| 84 | 2757974 | 2758177 | + | NZ_CP009555.1 | Burkholderia oklahomensis C6786 |
| 85 | 2073197 | 2073400 | + | NZ_CP022989.1 | Paraburkholderia aromaticivorans |
| 86 | 3479069 | 3479272 | - | NC_010681.1 | Paraburkholderia phytofirmans PsJN |
| 87 | 3887969 | 3888172 | - | NC_007951.1 | Paraburkholderia xenovorans LB400 |
| 88 | 3955019 | 3955222 | + | NC_008752.1 | Acidovorax citrulli AAC00-1 |
| 89 | 3963238 | 3963441 | + | NC_015138.1 | Acidovorax avenae subsp. avenae ATCC 19860 |
| 90 | 2064208 | 2064423 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 91 | 3702519 | 3702725 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 92 | 2538520 | 2538723 | - | NZ_CP027669.1 | Simplicispira suum |
| 93 | 153468 | 153671 | + | NZ_CP013119.1 | Alcaligenes faecalis |
| 94 | 1616576 | 1616776 | + | NZ_CP047650.1 | Xylophilus rhododendri |
| 95 | 1303985 | 1304188 | + | NZ_CP011568.3 | Pandoraea thiooxydans |
| 96 | 4441438 | 4441662 | + | NZ_CP061081.1 | Marinomonas arctica |
| 97 | 824206 | 824409 | - | NZ_CP054840.1 | Acidovorax antarcticus |
| 98 | 3485141 | 3485344 | + | NC_007908.1 | Rhodoferax ferrireducens T118 |
| 99 | 1014784 | 1014987 | - | NZ_CP019240.1 | Rhodoferax antarcticus |
| 100 | 4633383 | 4633586 | + | NZ_CP019236.1 | Rhodoferax koreense |
| 101 | 2250479 | 2250682 | + | NZ_CP046904.1 | Massilia flava |
| 102 | 4287988 | 4288191 | - | NZ_CP060790.1 | Acidovorax monticola |
| 103 | 1084704 | 1084907 | + | NZ_CP013459.1 | Burkholderia stagnalis |
| 104 | 2452819 | 2453028 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 105 | 733911 | 734114 | - | NZ_LT615228.1 | Polynucleobacter necessarius |
| 106 | 569119 | 569322 | - | NZ_CP022423.1 | Vitreoscilla filiformis |
| 107 | 3152939 | 3153142 | - | NZ_CP024941.1 | Paraburkholderia terricola |
| 108 | 689367 | 689570 | - | NZ_CP018787.1 | Oxalobacter formigenes |
| 109 | 1103717 | 1103920 | - | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 110 | 1081811 | 1082014 | - | NC_009379.1 | Polynucleobacter asymbioticus QLW-P1DMWA-1 |
| 111 | 4355846 | 4356049 | - | NZ_CP034464.1 | Undibacterium parvum |
| 112 | 1786519 | 1786722 | + | NC_007651.1 | Burkholderia thailandensis E264 |
| 113 | 1013712 | 1013915 | - | NZ_CP030086.1 | Polynucleobacter paneuropaeus |
| 114 | 712993 | 713196 | + | NZ_CP007501.1 | Polynucleobacter duraquae |
| 115 | 4852984 | 4853187 | + | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 116 | 563286 | 563489 | + | NZ_CP020046.1 | Thiomonas intermedia |
| 117 | 3815607 | 3815831 | + | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 118 | 700299 | 700502 | + | NZ_CP023276.1 | Polynucleobacter difficilis |
| 119 | 1305722 | 1305925 | + | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 120 | 979779 | 979982 | + | NZ_CP002580.1 | Burkholderia plantarii |
| 121 | 627313 | 627516 | - | NZ_CP011257.1 | Ralstonia mannitolilytica |
| 122 | 2305336 | 2305539 | - | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 123 | 2448813 | 2449016 | - | NZ_CP037993.1 | Herbaspirillum huttiense |
| 124 | 1281912 | 1282115 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 125 | 2395672 | 2395875 | - | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 126 | 1276350 | 1276553 | + | NZ_CP028901.1 | Algicoccus marinus |
| 127 | 662655 | 662873 | + | NZ_CP016796.1 | Francisella uliginis |
| 128 | 1220029 | 1220247 | - | NZ_CP022132.1 | Francisella halioticida |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028324.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03449.17 | 0.6 | 77 | 2631 | opposite-strand | Transcription elongation factor, N-terminal |
| 2 | PF01272.21 | 0.6 | 77 | 2631 | opposite-strand | Transcription elongation factor, GreA/GreB, C-term |
| 3 | PF13328.8 | 0.84 | 108 | 79.0 | same-strand | HD domain |
| 4 | PF04607.19 | 0.84 | 108 | 79.0 | same-strand | Region found in RelA / SpoT proteins |
| 5 | PF02824.23 | 0.84 | 108 | 79.0 | same-strand | TGS domain |
| 6 | PF13291.8 | 0.84 | 108 | 79.0 | same-strand | ACT domain |
| 7 | PF01966.24 | 0.84 | 108 | 79 | same-strand | HD domain |
| 8 | PF00625.23 | 0.84 | 108 | 58.0 | same-strand | Guanylate kinase |
| 9 | PF03755.15 | 0.72 | 92 | 750.5 | same-strand | YicC-like family, N-terminal region |
| 10 | PF08340.13 | 0.72 | 92 | 750.5 | same-strand | Domain of unknown function (DUF1732) |
++ More..