Result : C0QA34
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | CP001087.1 |
| Organism | Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) |
| Left | 4148624 |
| Right | 4148869 |
| Strand | - |
| Nucleotide Sequence | ATGCTTGTTCTTACACGGAAGGTTGGGGAGAGTATCAGGATATCCGATGATATCGTTGTCAAAGTCATTGATATCGGCAAAAACAGGATTCGCATCGGCATTGATGCGCCGTCGACCGTTTCCGTGTTAAGGAACGAGGTGTACGAAGAGATTCACCAGGAAAATATCCTTTCGTCACGGGGAAGCGTTACCGACTTGGCTAAGGCTGCCACCCTTTGGGCCAGAAAGAGTAAAAAAGAGGAATAA |
| Sequence | MLVLTRKVGESIRISDDIVVKVIDIGKNRIRIGIDAPSTVSVLRNEVYEEIHQENILSSRGSVTDLAKAATLWARKSKKEE |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 19187283 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | C0QA34 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4148624 | 4148869 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 2 | 2008259 | 2008504 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 3 | 2564767 | 2565012 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 4 | 3092697 | 3092930 | + | NC_013720.1 | Pirellula staleyi DSM 6068 |
| 5 | 439987 | 440214 | + | NZ_CP012024.1 | Bacillus smithii |
| 6 | 3487544 | 3487771 | - | NZ_LS483476.1 | Lederbergia lentus |
| 7 | 614490 | 614729 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012108.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02623.17 | 1.0 | 7 | 5 | same-strand | FliW protein |
| 2 | PF00669.22 | 1.0 | 7 | 782 | same-strand | Bacterial flagellin N-terminal helical region |
| 3 | PF00700.23 | 0.86 | 6 | 782 | same-strand | Bacterial flagellin C-terminal helical region |
| 4 | PF00460.22 | 0.71 | 5 | 2144 | same-strand | Flagella basal body rod protein |
| 5 | PF05130.14 | 0.71 | 5 | 5504 | same-strand | FlgN protein |
++ More..