Result : A1SPV1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000509.1 |
| Organism | Nocardioides sp. (strain ATCC BAA-499 / JS614) |
| Left | 4587049 |
| Right | 4587348 |
| Strand | - |
| Nucleotide Sequence | ATGTGTGGGCGCCCGGGCGATGATGGCGACATGCGCAGCGCCGTCGACGTGACCGTGACCGGCCGGGTCCAGGGCGTCTCGTTCCGCTACTACGCCGATCGCGAGGCGGACCGCCTCGGCGTTGCAGGGTGGGTGCGCAACGAGCCGGACGGCACGGTGGCGGCCCACGTCGAGGGTGACCCCGGCGCGGTGGCCGCCTTCGTCCGGTGGTGCCACGACGGCCCGCGGCTCGCGCACGTCGAGCAGGTCGACGTACGCGACGGGACCGACCAGGGGCTCAGGTCGTTCGGGGTCCGCTGA |
| Sequence | MCGRPGDDGDMRSAVDVTVTGRVQGVSFRYYADREADRLGVAGWVRNEPDGTVAAHVEGDPGAVAAFVRWCHDGPRLAHVEQVDVRDGTDQGLRSFGVR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | A1SPV1 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4244456 | 4244704 | - | NZ_CP059164.1 | Nocardioides ungokensis |
| 2 | 656931 | 657206 | - | NZ_CP047156.1 | Epidermidibacterium keratini |
| 3 | 3359363 | 3359611 | + | NZ_CP044344.1 | Nocardioides cynanchi |
| 4 | 1520142 | 1520417 | - | NZ_CP015101.1 | Thermococcus barossii |
| 5 | 1383091 | 1383366 | - | NZ_CP015106.1 | Thermococcus radiotolerans |
| 6 | 1363330 | 1363596 | - | NC_011529.1 | Thermococcus onnurineus NA1 |
| 7 | 331905 | 332180 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 8 | 1825590 | 1825865 | - | NC_006624.1 | Thermococcus kodakarensis KOD1 |
| 9 | 7727867 | 7728154 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 10 | 2190657 | 2190923 | - | NZ_CP040846.1 | Thermococcus indicus |
| 11 | 1813627 | 1813893 | - | NZ_LR881183.1 | Thermococcus camini |
| 12 | 293690 | 293965 | + | NZ_CP008887.1 | Thermococcus eurythermalis |
| 13 | 142527 | 142802 | + | NZ_LT900021.1 | Thermococcus henrietii |
| 14 | 291851 | 292126 | - | NZ_CP006019.1 | Palaeococcus pacificus DY20341 |
| 15 | 979627 | 979902 | - | NZ_CP007140.1 | Thermococcus guaymasensis DSM 11113 |
| 16 | 1191779 | 1192045 | + | NC_018015.1 | Thermococcus cleftensis |
| 17 | 1944897 | 1945148 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 18 | 1953996 | 1954247 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 19 | 3002553 | 3002807 | + | NZ_CP016282.1 | Cryobacterium arcticum |
| 20 | 6826374 | 6826619 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 21 | 7675980 | 7676249 | + | NZ_CP023691.1 | Streptomyces platensis |
| 22 | 547332 | 547577 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 23 | 2798764 | 2799021 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 24 | 316012 | 316260 | + | NZ_CP060782.1 | Sphingomonas sediminicola |
| 25 | 753437 | 753682 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 26 | 798130 | 798384 | + | NZ_CP007145.1 | Hymenobacter swuensis DY53 |
| 27 | 1539702 | 1539947 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 28 | 3468156 | 3468434 | + | NZ_CP050954.1 | Hymenobacter sp. BT18 |
| 29 | 6972554 | 6972805 | + | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 30 | 4887876 | 4888124 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 31 | 2558515 | 2558760 | - | NZ_CP038267.1 | Nocardioides euryhalodurans |
| 32 | 4197163 | 4197444 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 33 | 1020633 | 1020908 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 34 | 4130167 | 4130409 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 35 | 235812 | 236087 | - | NZ_CP015102.1 | Thermococcus pacificus |
| 36 | 2132831 | 2133076 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 37 | 430900 | 431148 | - | NZ_CP028913.1 | Agromyces badenianii |
| 38 | 301821 | 302096 | - | NZ_CP015103.1 | Thermococcus siculi |
| 39 | 2875508 | 2875753 | + | NZ_CP026949.1 | Mycetocola zhujimingii |
| 40 | 2496674 | 2496928 | + | NC_013172.1 | Brachybacterium faecium DSM 4810 |
| 41 | 285982 | 286236 | + | NC_016109.1 | Kitasatospora setae KM-6054 |
| 42 | 1652449 | 1652718 | - | NC_015588.1 | Isoptericola variabilis 225 |
++ More..