Result : C0H465
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YszA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2869754 |
| Right | 2869945 |
| Strand | + |
| Nucleotide Sequence | GTGAAGAAACGTTTCAGCTCTTATTCGCTGCCGCCATGGGTAAGGCAAATTCGGCTTGTATCCGCACAAGTGATTATTCCCATTACGATTTTTCAAGGAATCAGAACCATTTTCTTTCCGACAACCTTTGATGTTTTGCTGCTCGCAATCCTAATCTTTTTAGCTTGCGCCCTTCATTTAGAATGGATATAA |
| Sequence | MKKRFSSYSLPPWVRQIRLVSAQVIIPITIFQGIRTIFFPTTFDVLLLAILIFLACALHLEWI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H465 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 47
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2678171 | 2678362 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 2746192 | 2746383 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2869754 | 2869945 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 4 | 2603143 | 2603334 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 3427464 | 3427655 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 2685007 | 2685198 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 2823998 | 2824189 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 8 | 3014719 | 3014910 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 9 | 3162814 | 3163005 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 10 | 2750303 | 2750494 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 11 | 2656001 | 2656189 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 12 | 1859497 | 1859685 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 13 | 1265691 | 1265879 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 14 | 3273937 | 3274125 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 15 | 1292480 | 1292668 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 16 | 2903274 | 2903462 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 17 | 2489937 | 2490125 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 18 | 2814572 | 2814760 | - | NZ_CP043404.1 | Bacillus safensis |
| 19 | 3573030 | 3573218 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 20 | 629128 | 629316 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 21 | 2282695 | 2282883 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 22 | 1278231 | 1278422 | - | NZ_CP011937.1 | Bacillus velezensis |
| 23 | 3273305 | 3273496 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 24 | 2709600 | 2709791 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 25 | 3507694 | 3507885 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 26 | 2103829 | 2104020 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 27 | 932703 | 932894 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 28 | 2408144 | 2408335 | + | NZ_CP012024.1 | Bacillus smithii |
| 29 | 3547062 | 3547253 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 30 | 1573647 | 1573838 | - | NZ_LS483476.1 | Lederbergia lentus |
| 31 | 4236776 | 4236970 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 32 | 2752487 | 2752675 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 33 | 2161913 | 2162104 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 34 | 1476866 | 1477057 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 35 | 2790127 | 2790315 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 36 | 1158062 | 1158253 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 37 | 3337368 | 3337556 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 38 | 3155611 | 3155796 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 39 | 979133 | 979324 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 40 | 3226690 | 3226881 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 41 | 1875764 | 1875952 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 42 | 2912910 | 2913098 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 43 | 4432486 | 4432683 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 44 | 2347328 | 2347516 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 45 | 1550345 | 1550533 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 46 | 4038320 | 4038502 | + | NZ_CP026363.1 | Brevibacillus agri |
| 47 | 3920793 | 3920984 | + | NZ_CP017703.1 | Aeribacillus pallidus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08245.14 | 0.96 | 45 | 3216 | opposite-strand | Mur ligase middle domain |
| 2 | PF02875.23 | 0.87 | 41 | 3195 | opposite-strand | Mur ligase family, glutamate ligase domain |
| 3 | PF00133.24 | 0.91 | 43 | 462 | opposite-strand | tRNA synthetases class I (I, L, M and V) |
| 4 | PF08264.15 | 1.0 | 47 | 461 | opposite-strand | Anticodon-binding domain of tRNA ligase |
| 5 | PF10458.11 | 1.0 | 47 | 461 | opposite-strand | Valyl tRNA synthetase tRNA binding arm |
| 6 | PF01476.22 | 0.98 | 46 | 1115.0 | opposite-strand | LysM domain |
| 7 | PF00202.23 | 0.91 | 43 | 2705 | opposite-strand | Aminotransferase class-III |
| 8 | PF00490.23 | 0.89 | 42 | 4035.0 | opposite-strand | Delta-aminolevulinic acid dehydratase |
| 9 | PF02602.17 | 0.77 | 36 | 5009.0 | opposite-strand | Uroporphyrinogen-III synthase HemD |
++ More..