Result : C0H463
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YrzS |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2834957 |
| Right | 2835157 |
| Strand | - |
| Nucleotide Sequence | ATGACTGAATTTCCTAAGATCATTATGATTCTTGGTGCTGTTTTGCTTATTATCGGAGCAGTTTTGCATTTTGTCGGCAAGATGCCGGGAGATATTTTTGTAAAAAAAGGAAATGTTACGTTTTTCTTCCCGGTTGTCACTTGTATTATTATAAGTGTGGTATTATCAATTTTGCTTAATCTTTTTGGCAGAATGAAATAA |
| Sequence | MTEFPKIIMILGAVLLIIGAVLHFVGKMPGDIFVKKGNVTFFFPVVTCIIISVVLSILLNLFGRMK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11146. Profile Description: Protein of unknown function (DUF2905). This is a family of bacterial proteins conserved of unknown function. |
| Pubmed ID | 9384377 |
| Domain | CDD:402627 |
| Functional Category | Others |
| Uniprot ID | C0H463 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3462381 | 3462581 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 2 | 2643787 | 2643987 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2667845 | 2668045 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2834957 | 2835157 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 5 | 2568207 | 2568407 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 2650152 | 2650352 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 2715548 | 2715748 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 1306867 | 1307067 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2680935 | 2681135 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2847728 | 2847904 | + | NZ_CP043404.1 | Bacillus safensis |
| 11 | 2933307 | 2933483 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 2456924 | 2457100 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 2790096 | 2790296 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 3128799 | 3128999 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 15 | 2980833 | 2981006 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 16 | 1210224 | 1210424 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 3882166 | 3882366 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 18 | 4398628 | 4398828 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 19 | 4226648 | 4226848 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 20 | 4398359 | 4398559 | - | NC_011725.1 | Bacillus cereus B4264 |
| 21 | 4436291 | 4436491 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 22 | 4262796 | 4262996 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 23 | 3180512 | 3180712 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 24 | 972139 | 972339 | + | NZ_CP040336.1 | Bacillus luti |
| 25 | 2702623 | 2702829 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 26 | 3525369 | 3525575 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 27 | 4275029 | 4275235 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 28 | 2233746 | 2233952 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 29 | 2606618 | 2606785 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 30 | 1809933 | 1810100 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 31 | 1314895 | 1315062 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 32 | 3327149 | 3327316 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 33 | 883810 | 884016 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 34 | 3221308 | 3221508 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 35 | 2129521 | 2129703 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 36 | 973790 | 973969 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 37 | 1820811 | 1820975 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 38 | 2873708 | 2873899 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 39 | 1935436 | 1935606 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 40 | 3992178 | 3992357 | - | NZ_CP026363.1 | Brevibacillus agri |
| 41 | 2095115 | 2095321 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 42 | 1600925 | 1601131 | + | NZ_LS483476.1 | Lederbergia lentus |
| 43 | 3335408 | 3335569 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 44 | 1377253 | 1377474 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029364.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08955.12 | 0.82 | 36 | 1752.0 | same-strand | BofC C-terminal domain |
| 2 | PF08977.12 | 0.82 | 36 | 1752.0 | same-strand | Bypass of Forespore C, N terminal |
| 3 | PF01330.23 | 0.95 | 42 | 1009.0 | same-strand | RuvA N terminal domain |
| 4 | PF14520.8 | 0.95 | 42 | 1009.0 | same-strand | Helix-hairpin-helix domain |
| 5 | PF07499.15 | 0.95 | 42 | 1009.0 | same-strand | RuvA, C-terminal domain |
| 6 | PF05496.14 | 0.95 | 42 | -3.0 | same-strand | Holliday junction DNA helicase RuvB P-loop domain |
| 7 | PF17864.3 | 0.95 | 42 | -3.0 | same-strand | RuvB AAA lid domain |
| 8 | PF05491.15 | 0.95 | 42 | -3.0 | same-strand | RuvB C-terminal winged helix domain |
| 9 | PF00004.31 | 0.95 | 42 | -3.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 10 | PF07728.16 | 0.93 | 41 | -3 | same-strand | AAA domain (dynein-related subfamily) |
| 11 | PF02547.17 | 0.95 | 42 | 30.0 | same-strand | Queuosine biosynthesis protein |
| 12 | PF01702.20 | 0.95 | 42 | 1085.5 | same-strand | Queuine tRNA-ribosyltransferase |
| 13 | PF02699.17 | 0.95 | 42 | 2273.5 | same-strand | Preprotein translocase subunit |
| 14 | PF12670.9 | 0.89 | 39 | 2601 | opposite-strand | Protein of unknown function (DUF3792) |
| 15 | PF04239.14 | 0.61 | 27 | 3156 | same-strand | Protein of unknown function (DUF421) |
++ More..