Result : C0H461
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YrzQ |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2805348 |
| Right | 2805479 |
| Strand | - |
| Nucleotide Sequence | ATGAATCGGACGATGACTTCTCTTTTGGCAATGGGAGCCGGAGCTCTCGTGTACCGAATGGCGACTCAATCTGACATGCTGAATAATCGAAGCATGAAGCGGATGAGAAGAAGAATTACGAAAATGTTTTAA |
| Sequence | MNRTMTSLLAMGAGALVYRMATQSDMLNNRSMKRMRRRITKMF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13056. Profile Description: Protein of unknown function (DUF3918). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 40 amino acids in length. There are two completely conserved residues (G and R) that may be functionally important. |
| Pubmed ID | 9384377 |
| Domain | CDD:289801 |
| Functional Category | Others |
| Uniprot ID | C0H461 |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2805348 | 2805479 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2638114 | 2638245 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2612874 | 2613005 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2620593 | 2620724 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2685930 | 2686061 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2651443 | 2651574 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 7 | 1336461 | 1336592 | + | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 2951038 | 2951169 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 9 | 2760342 | 2760473 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 10 | 2198076 | 2198210 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 11 | 3098179 | 3098310 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 12 | 1388012 | 1388146 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 13 | 3492551 | 3492685 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 14 | 1251853 | 1251984 | + | NZ_CP016020.1 | Bacillus weihaiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033052.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01594.18 | 1.0 | 14 | 101.5 | same-strand | AI-2E family transporter |
| 2 | PF05239.18 | 0.64 | 9 | 223 | same-strand | PRC-barrel domain |
| 3 | PF13604.8 | 0.93 | 13 | 784 | same-strand | AAA domain |
| 4 | PF13245.8 | 0.93 | 13 | 784 | same-strand | AAA domain |
| 5 | PF14490.8 | 0.93 | 13 | 784 | same-strand | Helix-hairpin-helix containing domain |
| 6 | PF18335.3 | 0.93 | 13 | 784 | same-strand | ATP-dependent RecD-like DNA helicase SH3 domain |
| 7 | PF13538.8 | 0.93 | 13 | 784 | same-strand | UvrD-like helicase C-terminal domain |
| 8 | PF00515.30 | 0.93 | 13 | 3207 | same-strand | Tetratricopeptide repeat |
| 9 | PF07719.19 | 0.93 | 13 | 3207 | same-strand | Tetratricopeptide repeat |
| 10 | PF13181.8 | 0.93 | 13 | 3207 | same-strand | Tetratricopeptide repeat |
| 11 | PF13424.8 | 0.93 | 13 | 3207 | same-strand | Tetratricopeptide repeat |
| 12 | PF14559.8 | 0.86 | 12 | 3215.0 | same-strand | Tetratricopeptide repeat |
| 13 | PF13432.8 | 0.86 | 12 | 3206.0 | same-strand | Tetratricopeptide repeat |
| 14 | PF13431.8 | 0.64 | 9 | 3224 | same-strand | Tetratricopeptide repeat |
| 15 | PF13428.8 | 0.71 | 10 | 3223.5 | same-strand | Tetratricopeptide repeat |
| 16 | PF12895.9 | 0.71 | 10 | 3223.5 | same-strand | Anaphase-promoting complex, cyclosome, subunit 3 |
| 17 | PF03054.18 | 0.86 | 12 | 3933.0 | same-strand | tRNA methyl transferase |
| 18 | PF06949.13 | 0.64 | 9 | 4922 | same-strand | Protein of unknown function (DUF1292) |
| 19 | PF03652.17 | 0.64 | 9 | 4488 | same-strand | Holliday junction resolvase |
| 20 | PF06135.14 | 0.64 | 9 | 4214 | same-strand | IreB regulatory phosphoprotein |
| 21 | PF01411.21 | 0.64 | 9 | 1493 | same-strand | tRNA synthetases class II (A) |
| 22 | PF02272.21 | 0.64 | 9 | 1493 | same-strand | DHHA1 domain |
| 23 | PF07973.16 | 0.64 | 9 | 1493 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
++ More..