Result : C0H458
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YrzO |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2720526 |
| Right | 2720669 |
| Strand | - |
| Nucleotide Sequence | ATGTTTGAAGGTTTATTGTTTTTCATTTCAGCTGGAATTGTCTGTGAACTTGCTGCAATTAATAGAAATGGCCGCAAAAATATAAAGCAACAGGCCGAATTGATTCAAATTTTAAAAGAAAATCTTTATAAAGACATTAAATAA |
| Sequence | MFEGLLFFISAGIVCELAAINRNGRKNIKQQAELIQILKENLYKDIK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14142. Profile Description: YrzO-like protein. The YrzO-like protein family includes the B. subtilis YrzO protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 50 amino acids in length. |
| Pubmed ID | 9384377 |
| Domain | CDD:290847 |
| Functional Category | Others |
| Uniprot ID | C0H458 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2720526 | 2720669 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 708762 | 708905 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 3 | 1285333 | 1285476 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 2547966 | 2548100 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 202618 | 202758 | + | NC_011725.1 | Bacillus cereus B4264 |
| 6 | 201318 | 201458 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 7 | 4917289 | 4917429 | - | NZ_CP040336.1 | Bacillus luti |
| 8 | 203987 | 204127 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 9 | 206161 | 206301 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00892.22 | 1.0 | 9 | 22.0 | same-strand | EamA-like transporter family |
| 2 | PF03466.22 | 1.0 | 9 | 1118.0 | opposite-strand | LysR substrate binding domain |
| 3 | PF00126.29 | 1.0 | 9 | 1118.0 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
++ More..