Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YqzO |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2693457 |
Right | 2693606 |
Strand | - |
Nucleotide Sequence | TTGGGAATGAAAAAGAAAACGAATATAAAAGCAACTGGTGGACTTTATATATTTGGCCCTTCAAATCGAAATGAAGGTAAAGATCTTACACCAACAATCCGTTTACTTGAGGAAAAAATAAAGCAAATGGAGCGGATGCTGAGTGCTTAA |
Sequence | MGMKKKTNIKATGGLYIFGPSNRNEGKDLTPTIRLLEEKIKQMERMLSA |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H455 |
ORF Length (Amino Acid) | 49 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2693457 | 2693606 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2548454 | 2548603 | - | NZ_CP048852.1 | Bacillus tequilensis |
3 | 2199257 | 2199406 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
4 | 3078132 | 3078269 | + | NZ_CP029364.1 | Bacillus halotolerans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17356.4 | 1.0 | 4 | 713.5 | same-strand | Phage-like element PBSX protein XtrA |