Result : C0H455
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqzO |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2693457 |
| Right | 2693606 |
| Strand | - |
| Nucleotide Sequence | TTGGGAATGAAAAAGAAAACGAATATAAAAGCAACTGGTGGACTTTATATATTTGGCCCTTCAAATCGAAATGAAGGTAAAGATCTTACACCAACAATCCGTTTACTTGAGGAAAAAATAAAGCAAATGGAGCGGATGCTGAGTGCTTAA |
| Sequence | MGMKKKTNIKATGGLYIFGPSNRNEGKDLTPTIRLLEEKIKQMERMLSA |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H455 |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2693457 | 2693606 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2548454 | 2548603 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2199257 | 2199406 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 4 | 3078132 | 3078269 | + | NZ_CP029364.1 | Bacillus halotolerans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17356.4 | 1.0 | 4 | 713.5 | same-strand | Phage-like element PBSX protein XtrA |
++ More..