Result : C0H454
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqzN |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2680989 |
| Right | 2681180 |
| Strand | - |
| Nucleotide Sequence | ATGATGGCCACTAAAAAAGAGAAAGCAGAAAATGCTTTTTATATTAAGGATTTGCGAGAGCACAGTCGAGAGCTCTTTGGGGTAAAACCCGAGGTGTTTGACGGTGCTCTTTTTCATGTTCATAAAATGAGTATTACAAAATCGGAAGCGAAGAAGTTGATTTCTCAGTTTCTTCAAAAGGAGGTCAAATAG |
| Sequence | MMATKKEKAENAFYIKDLREHSRELFGVKPEVFDGALFHVHKMSITKSEAKKLISQFLQKEVK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H454 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2680989 | 2681180 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2808201 | 2808413 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 3 | 2501664 | 2501876 | + | NZ_CP043404.1 | Bacillus safensis |
| 4 | 1249563 | 1249781 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 653617 | 653829 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1499898 | 1500116 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 1339669 | 1339881 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1300642 | 1300860 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011150.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01464.22 | 1.0 | 8 | 2826.5 | same-strand | Transglycosylase SLT domain |
| 2 | PF08890.13 | 1.0 | 8 | 1935.5 | same-strand | Phage XkdN-like tail assembly chaperone protein, TAC |
| 3 | PF09393.12 | 1.0 | 8 | 1399.0 | same-strand | Phage tail tube protein |
| 4 | PF04984.16 | 1.0 | 8 | 0.0 | same-strand | Phage tail sheath protein subtilisin-like domain |
| 5 | PF17482.4 | 1.0 | 8 | 0.0 | same-strand | Phage tail sheath C-terminal domain |
| 6 | PF17481.4 | 0.75 | 6 | -1.0 | same-strand | Phage tail sheath protein beta-sandwich domain |
| 7 | PF04883.14 | 1.0 | 8 | 455.5 | same-strand | Bacteriophage HK97-gp10, putative tail-component |
| 8 | PF12206.10 | 1.0 | 8 | 940.5 | same-strand | Domain of unknown function (DUF3599) |
| 9 | PF11436.10 | 1.0 | 8 | 1293.5 | same-strand | Protein of unknown function (DUF3199) |
| 10 | PF05065.15 | 0.88 | 7 | 1697 | same-strand | Phage capsid family |
++ More..