Result : C0H453
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YqzM |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2637369 |
| Right | 2637503 |
| Strand | + |
| Nucleotide Sequence | TTGAATGATTTTGAAAAAAACGTTCAAAGCAAACGAAATGATGCTGTAGATTCAGCTGTTGGTTTTGTTGTGTCCTTCGGATTTTTCGCCTTCTTGTTTGTCATGGCAACGGTTATTCACCTAGTTGGTTCATAA |
| Sequence | MNDFEKNVQSKRNDAVDSAVGFVVSFGFFAFLFVMATVIHLVGS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14141. Profile Description: YqzM-like protein. The YqzM-like protein family includes the B. subtilis YqzM protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 40 amino acids in length. |
| Pubmed ID | 9384377 |
| Domain | CDD:372925 |
| Functional Category | Others |
| Uniprot ID | C0H453 |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 83
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2605728 | 2605862 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 2637369 | 2637503 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 2509464 | 2509598 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2496355 | 2496489 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3620405 | 3620539 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 2433983 | 2434117 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2510793 | 2510927 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 8 | 2584277 | 2584411 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1415535 | 1415669 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2331986 | 2332120 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 11 | 3043353 | 3043487 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 2955033 | 2955167 | - | NZ_CP043404.1 | Bacillus safensis |
| 13 | 1282815 | 1282949 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 14 | 4347442 | 4347576 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 15 | 4308374 | 4308508 | + | NC_011725.1 | Bacillus cereus B4264 |
| 16 | 4173949 | 4174083 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 17 | 1060187 | 1060321 | - | NZ_CP040336.1 | Bacillus luti |
| 18 | 3093681 | 3093815 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 19 | 4138426 | 4138560 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 20 | 3143477 | 3143611 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 21 | 3384823 | 3384957 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 22 | 4334454 | 4334588 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 23 | 2151289 | 2151423 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 24 | 3828709 | 3828840 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 25 | 3456451 | 3456585 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 26 | 1424330 | 1424464 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 27 | 2920261 | 2920392 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 28 | 2806762 | 2806893 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 29 | 2645715 | 2645846 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 30 | 1976368 | 1976502 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 31 | 2587857 | 2587991 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 32 | 746019 | 746153 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 33 | 3403493 | 3403627 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 34 | 1402463 | 1402597 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 35 | 1734728 | 1734862 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 36 | 2533888 | 2534022 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 37 | 3345150 | 3345284 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 38 | 1210271 | 1210405 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 39 | 1467170 | 1467304 | - | NZ_CP059540.1 | Planococcus maritimus |
| 40 | 1457164 | 1457298 | - | NZ_CP016538.2 | Planococcus maritimus |
| 41 | 2547533 | 2547667 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 42 | 1660562 | 1660696 | - | NZ_LS483476.1 | Lederbergia lentus |
| 43 | 1582582 | 1582716 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 44 | 1493396 | 1493530 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 45 | 1430564 | 1430698 | - | NZ_CP016540.2 | Planococcus versutus |
| 46 | 1593345 | 1593479 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 47 | 1504046 | 1504180 | - | NZ_CP019401.1 | Planococcus faecalis |
| 48 | 278938 | 279072 | + | NZ_CP013661.2 | Planococcus kocurii |
| 49 | 1315061 | 1315195 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 50 | 2081160 | 2081294 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 51 | 1463480 | 1463614 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 52 | 1408599 | 1408733 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 53 | 4033424 | 4033558 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 54 | 2550309 | 2550443 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 55 | 92579 | 92710 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 56 | 2117748 | 2117882 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 57 | 1334403 | 1334537 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 58 | 1084027 | 1084164 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 59 | 4300 | 4440 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 60 | 1771215 | 1771355 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 61 | 3446050 | 3446184 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 62 | 100475 | 100591 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 63 | 2302086 | 2302217 | + | NZ_CP012024.1 | Bacillus smithii |
| 64 | 752770 | 752904 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 65 | 3330234 | 3330368 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 66 | 4407384 | 4407518 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 67 | 1559574 | 1559711 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 68 | 2793196 | 2793327 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 69 | 1894038 | 1894172 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 70 | 785981 | 786115 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 71 | 1420713 | 1420850 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 72 | 1559592 | 1559729 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 73 | 3094586 | 3094723 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 74 | 967437 | 967550 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 75 | 3431393 | 3431527 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 76 | 3426737 | 3426871 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 77 | 1534377 | 1534511 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 78 | 326792 | 326926 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 79 | 2259725 | 2259859 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 80 | 2069448 | 2069582 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 81 | 1138687 | 1138821 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 82 | 1355630 | 1355764 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 83 | 1086500 | 1086634 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 84 | 2006776 | 2006910 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033052.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07454.13 | 0.6 | 50 | 3075.0 | opposite-strand | Stage II sporulation protein P (SpoIIP) |
| 2 | PF03418.16 | 0.81 | 67 | 1885 | opposite-strand | Germination protease |
| 3 | PF01649.20 | 1.0 | 83 | 1403.5 | same-strand | Ribosomal protein S20 |
| 4 | PF06144.15 | 1.0 | 83 | 280.5 | opposite-strand | DNA polymerase III, delta subunit |
| 5 | PF03772.18 | 1.0 | 83 | 55.0 | opposite-strand | Competence protein |
| 6 | PF13567.8 | 0.72 | 60 | 57.0 | opposite-strand | Domain of unknown function (DUF4131) |
| 7 | PF00753.29 | 0.92 | 76 | 55 | opposite-strand | Metallo-beta-lactamase superfamily |
| 8 | PF00383.25 | 0.95 | 79 | 2373.0 | opposite-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
| 9 | PF12836.9 | 0.96 | 80 | 3007 | opposite-strand | Helix-hairpin-helix motif |
| 10 | PF00633.25 | 0.83 | 69 | 3007.0 | opposite-strand | Helix-hairpin-helix motif |
| 11 | PF10531.11 | 0.84 | 70 | 3010.0 | opposite-strand | SLBB domain |
| 12 | PF03807.19 | 0.63 | 52 | 3711.5 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
| 13 | PF14748.8 | 0.61 | 51 | 3712 | same-strand | Pyrroline-5-carboxylate reductase dimerisation |
| 14 | PF13649.8 | 0.86 | 71 | 4598.0 | opposite-strand | Methyltransferase domain |
| 15 | PF08241.14 | 0.86 | 71 | 4598.0 | opposite-strand | Methyltransferase domain |
| 16 | PF13489.8 | 0.82 | 68 | 4598.0 | opposite-strand | Methyltransferase domain |
| 17 | PF08242.14 | 0.86 | 71 | 4598.0 | opposite-strand | Methyltransferase domain |
++ More..