Result : C0H452
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqzL |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2609750 |
| Right | 2609893 |
| Strand | - |
| Nucleotide Sequence | GTGTTGAATTTTACCTGGAACGTATTTTCTCAAACAGGAAATGTTGATACGTATCTTCTTTTTAAAGAACTGGAAAAAGAGAACATGGAAAGACCCGAAGAACTAGAAGATGAGCTAGCCCGATTTGATTATCCAATTTTATAA |
| Sequence | MLNFTWNVFSQTGNVDTYLLFKELEKENMERPEELEDELARFDYPIL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14006. Profile Description: YqzL-like protein. The YqzL-like protein family includes the B. subtilis YqzL protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 50 amino acids in length. |
| Pubmed ID | 9384377 |
| Domain | CDD:379412 |
| Functional Category | Others |
| Uniprot ID | C0H452 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 50
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2609750 | 2609893 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2468745 | 2468888 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2483180 | 2483323 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2481852 | 2481995 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2578117 | 2578260 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 3648020 | 3648163 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2406355 | 2406498 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1443159 | 1443302 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2983082 | 2983225 | + | NZ_CP043404.1 | Bacillus safensis |
| 10 | 2556644 | 2556787 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 11 | 2617116 | 2617259 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 2775876 | 2776019 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 2303901 | 2304044 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 2888626 | 2888769 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 15 | 3071783 | 3071929 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 16 | 3450097 | 3450240 | - | NZ_CP053989.1 | Niallia circulans |
| 17 | 1312403 | 1312546 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 18 | 723170 | 723313 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 19 | 3354855 | 3354998 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 20 | 3476245 | 3476388 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 21 | 4437891 | 4438034 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 22 | 3400795 | 3400938 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 23 | 4308506 | 4308649 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 24 | 1449991 | 1450134 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 25 | 3107210 | 3107350 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 26 | 3375187 | 3375327 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 27 | 2125200 | 2125343 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 28 | 1952772 | 1952915 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 29 | 4064133 | 4064270 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 30 | 1622644 | 1622787 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 31 | 2564421 | 2564561 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 32 | 2508072 | 2508215 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 33 | 3429300 | 3429443 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 34 | 1428385 | 1428528 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 35 | 1708912 | 1709055 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 36 | 771978 | 772121 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 37 | 3430742 | 3430885 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 38 | 2518689 | 2518829 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 39 | 3795810 | 3795950 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 40 | 3068972 | 3069115 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 41 | 1084067 | 1084210 | + | NZ_CP040336.1 | Bacillus luti |
| 42 | 4114538 | 4114681 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 43 | 4283437 | 4283580 | - | NC_011725.1 | Bacillus cereus B4264 |
| 44 | 4323405 | 4323548 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 45 | 4150130 | 4150273 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 46 | 761612 | 761755 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 47 | 60999 | 61142 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 48 | 954152 | 954298 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 49 | 2914665 | 2914802 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 50 | 1689098 | 1689241 | + | NZ_LS483476.1 | Lederbergia lentus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03618.16 | 0.98 | 49 | 4790 | same-strand | Kinase/pyrophosphorylase |
| 2 | PF00571.30 | 0.94 | 47 | 4151 | same-strand | CBS domain |
| 3 | PF08279.14 | 0.88 | 44 | 4151.0 | same-strand | HTH domain |
| 4 | PF02565.17 | 1.0 | 50 | 34.0 | same-strand | Recombination protein O C terminal |
| 5 | PF11967.10 | 1.0 | 50 | 34.0 | same-strand | Recombination protein O N terminal |
| 6 | PF13114.8 | 1.0 | 50 | 34.0 | same-strand | RecO N terminal |
| 7 | PF01926.25 | 1.0 | 50 | 146.5 | same-strand | 50S ribosome-binding GTPase |
| 8 | PF07650.19 | 1.0 | 50 | 146.5 | same-strand | KH domain |
| 9 | PF02421.20 | 1.0 | 50 | 146.5 | same-strand | Ferrous iron transport protein B |
| 10 | PF10662.11 | 0.66 | 33 | 145 | same-strand | Ethanolamine utilisation - propanediol utilisation |
| 11 | PF00383.25 | 0.92 | 46 | 1044.0 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
| 12 | PF01219.21 | 1.0 | 50 | 1561.0 | same-strand | Prokaryotic diacylglycerol kinase |
| 13 | PF02130.19 | 1.0 | 50 | 1916.5 | same-strand | Endoribonuclease YbeY |
| 14 | PF07698.13 | 0.92 | 46 | 2389.5 | same-strand | 7TM receptor with intracellular HD hydrolase |
| 15 | PF07697.13 | 0.92 | 46 | 2389.5 | same-strand | 7TM-HD extracellular |
| 16 | PF01966.24 | 0.94 | 47 | 2389 | same-strand | HD domain |
++ More..