Result : C0H451
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YqzK |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2449489 |
| Right | 2449716 |
| Strand | - |
| Nucleotide Sequence | ATGGGAAGATTCCTGAAAACAGCTGTCGATGCATTGAAAGTTTTCATCCTGTTTACCGGTTTTACCGCTTTGTTCTATTATGCTATGATATGGGTGAATCAAGAGTATGAAAACTATCATCGGTATGATAAACCGGAAGGCTCCGCTGTAAAAGTTGTTGAAATGGATCAGGATGAAAAAGGCGGATGGTTCGACCGGTTGATCTTTTTTTACCAAAACGGGGAGTAG |
| Sequence | MGRFLKTAVDALKVFILFTGFTALFYYAMIWVNQEYENYHRYDKPEGSAVKVVEMDQDEKGGWFDRLIFFYQNGE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14004. Profile Description: Protein of unknown function (DUF4227). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length. |
| Pubmed ID | 9384377 |
| Domain | CDD:372877 |
| Functional Category | Others |
| Uniprot ID | C0H451 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 48
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2449489 | 2449716 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2317593 | 2317820 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2322414 | 2322641 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2309304 | 2309531 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 2408496 | 2408723 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2245782 | 2246009 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3808402 | 3808629 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1668459 | 1668686 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2331281 | 2331508 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2431988 | 2432170 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2651656 | 2651838 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 12 | 2532270 | 2532452 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 3229309 | 3229536 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 2146312 | 2146539 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 3142017 | 3142244 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 3634027 | 3634254 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 17 | 1509615 | 1509842 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 18 | 2819663 | 2819890 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 19 | 1858407 | 1858634 | + | NZ_LS483476.1 | Lederbergia lentus |
| 20 | 1932228 | 1932440 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 21 | 1766540 | 1766746 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 22 | 4169313 | 4169540 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 23 | 1582635 | 1582829 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 24 | 3564840 | 3565070 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 25 | 3191369 | 3191563 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 26 | 5050869 | 5051102 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 27 | 3641179 | 3641406 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 28 | 1605817 | 1605999 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 29 | 3285328 | 3285522 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 30 | 1796228 | 1796440 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 31 | 3217098 | 3217328 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 32 | 2379840 | 2380028 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 33 | 2346066 | 2346278 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 34 | 1548220 | 1548432 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 35 | 1600034 | 1600246 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 36 | 3607616 | 3607828 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 37 | 3249460 | 3249690 | - | NZ_CP053989.1 | Niallia circulans |
| 38 | 3939986 | 3940216 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 39 | 2123172 | 2123360 | - | NZ_CP012024.1 | Bacillus smithii |
| 40 | 2863254 | 2863484 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 41 | 1263130 | 1263360 | + | NZ_CP040336.1 | Bacillus luti |
| 42 | 3969513 | 3969743 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 43 | 4100943 | 4101173 | - | NC_011725.1 | Bacillus cereus B4264 |
| 44 | 4108859 | 4109089 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 45 | 916551 | 916763 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 46 | 652972 | 653172 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 47 | 2414785 | 2414979 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 48 | 2131294 | 2131479 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017703.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00768.22 | 0.77 | 37 | 4127 | same-strand | D-alanyl-D-alanine carboxypeptidase |
| 2 | PF07943.15 | 0.79 | 38 | 4211.5 | same-strand | Penicillin-binding protein 5, C-terminal domain |
| 3 | PF01048.22 | 0.94 | 45 | 2287 | same-strand | Phosphorylase superfamily |
| 4 | PF01676.20 | 0.98 | 47 | 1091 | same-strand | Metalloenzyme superfamily |
| 5 | PF00589.24 | 1.0 | 48 | 7.0 | same-strand | Phage integrase family |
| 6 | PF02899.19 | 1.0 | 48 | 7.0 | same-strand | Phage integrase, N-terminal SAM-like domain |
| 7 | PF13495.8 | 1.0 | 48 | 7.0 | same-strand | Phage integrase, N-terminal SAM-like domain |
| 8 | PF01475.21 | 1.0 | 48 | 124.0 | same-strand | Ferric uptake regulator family |
| 9 | PF01944.19 | 1.0 | 48 | 687.0 | same-strand | Stage II sporulation protein M |
| 10 | PF00591.23 | 0.6 | 29 | 3188 | same-strand | Glycosyl transferase family, a/b domain |
| 11 | PF02885.19 | 0.6 | 29 | 3188 | same-strand | Glycosyl transferase family, helical bundle domain |
| 12 | PF07831.15 | 0.6 | 29 | 3188 | same-strand | Pyrimidine nucleoside phosphorylase C-terminal domain |
| 13 | PF00293.30 | 0.62 | 30 | 2686.0 | same-strand | NUDIX domain |
++ More..