Result : C0H447
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YpzJ |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2433316 |
| Right | 2433522 |
| Strand | - |
| Nucleotide Sequence | ATGAACAACAAAGGCTGTATAAAATGCGGTAGTACTGAAGCCGGACAAAAAGAAATAGCTACAACCGGCACGGGATTATCAAAGCTGTTTGACGTGCAGCATAACCGATTTCTAGTGGTTTACTGTAAGAACTGCGGATATTCAGAGTTTTATAATAAAGAGTCTTCAACTGCCGGGAATATATTGGATTTATTTTTTGGAGGCTGA |
| Sequence | MNNKGCIKCGSTEAGQKEIATTGTGLSKLFDVQHNRFLVVYCKNCGYSEFYNKESSTAGNILDLFFGG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01381. Profile Description: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082). This domain, found in various hypothetical prokaryotic proteins, as well as some Zn-ribbon nucleic-acid-binding proteins has no known function. |
| Pubmed ID | 9384377 19383706 |
| Domain | CDD:412868 |
| Functional Category | Others |
| Uniprot ID | C0H447 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 85
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2302711 | 2302917 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 2433316 | 2433522 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 2393760 | 2393966 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2294299 | 2294505 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 2231065 | 2231271 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3823240 | 3823446 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2305596 | 2305829 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 3148466 | 3148675 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 9 | 3336391 | 3336600 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 10 | 1991013 | 1991219 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 11 | 405112 | 405318 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 12 | 409244 | 409429 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 13 | 3915728 | 3915931 | + | NZ_CP021434.1 | Tumebacillus avium |
| 14 | 678650 | 678856 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 15 | 1487914 | 1488120 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 16 | 417346 | 417552 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 17 | 887014 | 887217 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 18 | 4179175 | 4179378 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 19 | 3337695 | 3337898 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 20 | 2769649 | 2769855 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 21 | 5244519 | 5244704 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 22 | 3090456 | 3090662 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 23 | 788305 | 788508 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 24 | 3491278 | 3491481 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 25 | 3291863 | 3292066 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 26 | 338193 | 338402 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 27 | 2735279 | 2735482 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 28 | 2248726 | 2248932 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 29 | 757033 | 757236 | + | NZ_CP053989.1 | Niallia circulans |
| 30 | 1181165 | 1181371 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 31 | 2391341 | 2391547 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 32 | 200260 | 200469 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 33 | 1277298 | 1277507 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 34 | 1148090 | 1148293 | + | NC_015666.1 | Halopiger xanaduensis SH-6 |
| 35 | 132785 | 133000 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 36 | 1173229 | 1173447 | - | NC_000909.1 | Methanocaldococcus jannaschii DSM 2661 |
| 37 | 2361594 | 2361761 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 38 | 977261 | 977476 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 39 | 1635606 | 1635827 | - | NZ_CP058579.1 | Halobaculum salinum |
| 40 | 1383055 | 1383258 | - | NZ_CP019285.1 | Halobiforma lacisalsi AJ5 |
| 41 | 197560 | 197769 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 42 | 2514195 | 2514410 | + | NC_014729.1 | Halogeometricum borinquense DSM 11551 |
| 43 | 1156656 | 1156862 | + | NZ_CP031305.1 | Natronorubrum bangense |
| 44 | 526899 | 527117 | - | NZ_CP058335.1 | Natronomonas salina |
| 45 | 1185008 | 1185214 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 46 | 1282946 | 1283149 | - | NZ_CP071463.1 | Haloterrigena longa |
| 47 | 575528 | 575746 | - | NZ_CP026309.1 | Salinigranum rubrum |
| 48 | 1626703 | 1626873 | - | NZ_CP058529.1 | Halobaculum halophilum |
| 49 | 3467173 | 3467376 | + | NC_013743.1 | Haloterrigena turkmenica DSM 5511 |
| 50 | 1771108 | 1771317 | + | NZ_CP034345.1 | Haloplanus rallus |
| 51 | 1905056 | 1905223 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 52 | 626003 | 626221 | + | NC_013158.1 | Halorhabdus utahensis DSM 12940 |
| 53 | 629480 | 629689 | - | NZ_CP034145.1 | Haloplanus aerogenes |
| 54 | 493421 | 493636 | - | NZ_CP011947.1 | Haloferax gibbonsii |
| 55 | 558605 | 558820 | - | NZ_CP048738.1 | Haloferax alexandrinus |
| 56 | 1201660 | 1201884 | - | NZ_CP081958.1 | Halobaculum magnesiiphilum |
| 57 | 1150784 | 1151008 | - | NZ_CP082286.1 | Halobaculum roseum |
| 58 | 2599335 | 2599538 | - | NC_019964.1 | Halovivax ruber XH-70 |
| 59 | 2310913 | 2311116 | + | NZ_CP007055.1 | Halostagnicola larsenii XH-48 |
| 60 | 1986836 | 1987024 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 61 | 371442 | 371660 | + | NC_021921.1 | Halorhabdus tiamatea SARL4B |
| 62 | 1156451 | 1156666 | - | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 63 | 1098281 | 1098490 | - | NZ_CP031150.1 | Haloplanus rubicundus |
| 64 | 86896 | 87099 | + | NZ_CP011039.1 | Pseudoalteromonas spongiae UST010723-006 |
| 65 | 513578 | 513793 | - | NC_013967.1 | Haloferax volcanii DS2 |
| 66 | 409950 | 410168 | + | NZ_CP058334.1 | Natronomonas halophila |
| 67 | 1070539 | 1070763 | - | NZ_CP019154.1 | Haloarcula taiwanensis |
| 68 | 1082034 | 1082258 | - | NC_015948.1 | Haloarcula hispanica ATCC 33960 |
| 69 | 1523991 | 1524215 | + | NZ_CP073366.1 | Haloarcula sinaiiensis ATCC 33800 |
| 70 | 435451 | 435675 | + | NC_006396.1 | Haloarcula marismortui ATCC 43049 |
| 71 | 8652930 | 8653097 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 72 | 809301 | 809504 | + | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 73 | 785126 | 785332 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 74 | 2939098 | 2939334 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 75 | 4443519 | 4443746 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 76 | 1605905 | 1606111 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 77 | 119343 | 119555 | - | NZ_CP009530.1 | Methanosarcina barkeri 227 |
| 78 | 2952546 | 2952758 | - | NZ_CP009520.1 | Methanosarcina vacuolata Z-761 |
| 79 | 727934 | 728119 | + | NZ_CP013011.1 | Pyrodictium delaneyi |
| 80 | 152923 | 153111 | + | NZ_CP009501.1 | Methanosarcina thermophila TM-1 |
| 81 | 437141 | 437329 | - | NZ_CP032683.1 | Methanosarcina flavescens |
| 82 | 163732 | 163941 | - | NC_003901.1 | Methanosarcina mazei Go1 |
| 83 | 4067628 | 4067837 | - | NC_003552.1 | Methanosarcina acetivorans C2A |
| 84 | 2766523 | 2766732 | - | NZ_CP009515.1 | Methanosarcina lacustris Z-7289 |
| 85 | 1674770 | 1674979 | + | NZ_CP009516.1 | Methanosarcina horonobensis HB-1 = JCM 15518 |
++ More..