Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YpzI |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2393422 |
Right | 2393559 |
Strand | + |
Nucleotide Sequence | ATGATCATGGGAAAAGACAGACAAGAGAAAAAACTCAAAGCTTCAGGCAGAGTCGAATCAGATCGCGACCAGTCCATTCACTATGACGGAGCGACAAGCCTTGAACAAAACGGAAGATTCAAAAAGCGAAAATCATAA |
Sequence | MIMGKDRQEKKLKASGRVESDRDQSIHYDGATSLEQNGRFKKRKS |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam14140. Profile Description: YpzI-like protein. The YpzI-like protein family includes the B. subtilis YpzI protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 40 amino acids in length. |
Pubmed ID | 9384377 |
Domain | CDD:290845 |
Functional Category | Others |
Uniprot ID | C0H446 |
ORF Length (Amino Acid) | 45 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2393422 | 2393559 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2262723 | 2262860 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 3863069 | 3863206 | - | NZ_CP029364.1 | Bacillus halotolerans |
4 | 2191349 | 2191486 | + | NZ_CP051464.1 | Bacillus mojavensis |
5 | 2202584 | 2202721 | + | NZ_CP013984.1 | Bacillus inaquosorum |
6 | 2265524 | 2265661 | + | NZ_CP048852.1 | Bacillus tequilensis |
7 | 2350615 | 2350752 | + | NZ_CP033052.1 | Bacillus vallismortis |
8 | 2277564 | 2277695 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
9 | 1722251 | 1722382 | - | NZ_CP011937.1 | Bacillus velezensis |
10 | 613312 | 613440 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
11 | 3197134 | 3197268 | - | NZ_CP043404.1 | Bacillus safensis |
12 | 4288089 | 4288220 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
13 | 2409731 | 2409859 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
14 | 4951737 | 4951868 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
15 | 4644009 | 4644140 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
16 | 2037535 | 2037663 | + | NZ_CP020772.1 | Halobacillus mangrovi |
17 | 2466441 | 2466572 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
18 | 3204560 | 3204694 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
19 | 509051 | 509182 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
20 | 2364283 | 2364414 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
21 | 2034901 | 2035038 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
22 | 1721758 | 1721868 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
23 | 3145186 | 3145326 | + | NZ_LS483476.1 | Lederbergia lentus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07479.16 | 0.83 | 19 | 3234 | opposite-strand | NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus |
2 | PF01210.25 | 0.83 | 19 | 3234 | opposite-strand | NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus |
3 | PF03807.19 | 0.83 | 19 | 3234 | opposite-strand | NADP oxidoreductase coenzyme F420-dependent |
4 | PF01926.25 | 0.87 | 20 | 1900.0 | opposite-strand | 50S ribosome-binding GTPase |
5 | PF14714.8 | 0.87 | 20 | 1900.0 | opposite-strand | KH-domain-like of EngA bacterial GTPase enzymes, C-terminal |
6 | PF02421.20 | 0.87 | 20 | 1900.0 | opposite-strand | Ferrous iron transport protein B |
7 | PF00575.25 | 0.87 | 20 | 1105.5 | opposite-strand | S1 RNA binding domain |
8 | PF02224.20 | 0.83 | 19 | 2486 | opposite-strand | Cytidylate kinase |
9 | PF13189.8 | 0.83 | 19 | 2486 | opposite-strand | Cytidylate kinase-like family |
10 | PF13238.8 | 0.78 | 18 | 2487.0 | opposite-strand | AAA domain |
11 | PF17313.4 | 0.74 | 17 | 3241 | opposite-strand | Family of unknown function (DUF5359) |