Result : C0H445
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YpzH |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2391670 |
| Right | 2391864 |
| Strand | - |
| Nucleotide Sequence | ATGAGTGAATCTCTTACGAAAGTGATTTTGTCTGTAATCACGACAAATCGAAATCGGGTTGCAGGGGGAGCACCTGTCTTTTTTTGCAATGACCAAAAGGAGATGGAGCTTTTCGCTAAAAATCTTGAGGCGATCCTTGATGGAATAGCTCACAGAATCGGAGATGACGTGTATTTGATCGTGAAACATTTTTAA |
| Sequence | MSESLTKVILSVITTNRNRVAGGAPVFFCNDQKEMELFAKNLEAILDGIAHRIGDDVYLIVKHF |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H445 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 43
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2391670 | 2391864 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2200832 | 2201026 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2260971 | 2261165 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2263772 | 2263966 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 3864767 | 3864961 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 2348863 | 2349057 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 2189594 | 2189788 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2362521 | 2362715 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 9 | 2464679 | 2464873 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 10 | 3577006 | 3577194 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 11 | 2586263 | 2586430 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 12 | 3289964 | 3290158 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 2089766 | 2089960 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 3198876 | 3199070 | + | NZ_CP043404.1 | Bacillus safensis |
| 15 | 1834169 | 1834354 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 16 | 1574146 | 1574334 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 3202769 | 3202954 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 18 | 24337 | 24501 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 19 | 3702092 | 3702256 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 20 | 1665174 | 1665344 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 21 | 2086530 | 2086715 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 22 | 2262295 | 2262459 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 23 | 1689402 | 1689566 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 24 | 1860937 | 1861095 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 25 | 1330311 | 1330490 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 26 | 1489740 | 1489922 | + | NC_011725.1 | Bacillus cereus B4264 |
| 27 | 1439661 | 1439843 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 28 | 3196209 | 3196394 | - | NZ_CP053989.1 | Niallia circulans |
| 29 | 1440936 | 1441118 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 30 | 3645507 | 3645689 | - | NZ_CP040336.1 | Bacillus luti |
| 31 | 1457277 | 1457459 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 32 | 1473578 | 1473742 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 33 | 3128073 | 3128231 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 34 | 2757134 | 2757319 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 35 | 3697278 | 3697463 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 36 | 996931 | 997095 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 37 | 1872680 | 1872865 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 38 | 3621010 | 3621192 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 39 | 2063958 | 2064149 | - | NZ_CP012024.1 | Bacillus smithii |
| 40 | 2149243 | 2149422 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 41 | 3613613 | 3613798 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 42 | 2279723 | 2279902 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 43 | 1719991 | 1720158 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 44 | 2323840 | 2324010 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09547.12 | 0.67 | 29 | 4001.5 | same-strand | Stage IV sporulation protein A (spore IV A) |
| 2 | PF01926.25 | 1.0 | 43 | 210 | same-strand | 50S ribosome-binding GTPase |
| 3 | PF10966.10 | 0.93 | 40 | 3019 | same-strand | Protein of unknown function (DUF2768) |
| 4 | PF07479.16 | 1.0 | 43 | 1497.5 | same-strand | NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus |
| 5 | PF01210.25 | 1.0 | 43 | 1497.5 | same-strand | NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus |
| 6 | PF03807.19 | 0.95 | 41 | 1497.0 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
| 7 | PF14714.8 | 1.0 | 43 | 159.5 | same-strand | KH-domain-like of EngA bacterial GTPase enzymes, C-terminal |
| 8 | PF02421.20 | 1.0 | 43 | 159.5 | same-strand | Ferrous iron transport protein B |
| 9 | PF14045.8 | 1.0 | 43 | 3 | same-strand | YIEGIA protein |
| 10 | PF14140.8 | 0.67 | 29 | 1614.0 | opposite-strand | YpzI-like protein |
| 11 | PF00575.25 | 0.95 | 41 | 2800 | same-strand | S1 RNA binding domain |
++ More..