Result : C0H444
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YpzG |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2329870 |
| Right | 2330022 |
| Strand | + |
| Nucleotide Sequence | ATGAGTTATAGAAACCGATTAGATCAGCATTCTGAACTGTTTCATCACAATTGGACGCGGCCTAAACGTTCAAAGTCTCAAGTAAACGGTCACACTGAAATGTCCCAAACCAACATTATATTGAGAAGCAACGCGAAAGCTCACCGTTGGTAA |
| Sequence | MSYRNRLDQHSELFHHNWTRPKRSKSQVNGHTEMSQTNIILRSNAKAHRW |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14139. Profile Description: YpzG-like protein. The YpzG-like protein family includes the B. subtilis YpzG protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 50 amino acids in length. There is a conserved QVNG sequence motif. |
| Pubmed ID | 9384377 |
| Domain | CDD:404939 |
| Functional Category | Others |
| Uniprot ID | C0H444 |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2329870 | 2330022 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2199148 | 2199300 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2139000 | 2139152 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2285484 | 2285636 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2201993 | 2202145 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 3926623 | 3926775 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2127797 | 2127949 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2213836 | 2213988 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1785977 | 1786129 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 3147077 | 3147229 | + | NZ_CP053989.1 | Niallia circulans |
| 11 | 616682 | 616834 | - | NZ_CP012024.1 | Bacillus smithii |
| 12 | 1546292 | 1546444 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 13 | 279729 | 279881 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 14 | 3112353 | 3112505 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 15 | 3453050 | 3453202 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 16 | 484757 | 484909 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 17 | 1875218 | 1875370 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 18 | 486237 | 486389 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 19 | 382365 | 382517 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 20 | 2030563 | 2030715 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 21 | 4613215 | 4613367 | + | NZ_CP040336.1 | Bacillus luti |
| 22 | 513086 | 513238 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 23 | 509027 | 509179 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 24 | 506902 | 507054 | - | NC_011725.1 | Bacillus cereus B4264 |
| 25 | 497582 | 497734 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 26 | 487911 | 488063 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 27 | 3028607 | 3028762 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 28 | 2752071 | 2752223 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 29 | 1921498 | 1921650 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 30 | 1941354 | 1941506 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
++ More..