Result : C0H443
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YpzF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2311986 |
| Right | 2312132 |
| Strand | - |
| Nucleotide Sequence | ATGTTGGGCAGAACAAAGCTCGGAAACAGAAATGCACAGGCGAATAACAACGCCAAAAAGAAAAACGGATTTCAAACCCATTTTGACTCTTACGCAGGACGCGAAGCTGAAAAGCTGATCGCCAGCAACAAAAGACACAACGATTGA |
| Sequence | MLGRTKLGNRNAQANNNAKKKNGFQTHFDSYAGREAEKLIASNKRHND |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H443 |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2181258 | 2181404 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 2311986 | 2312132 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 2109890 | 2110036 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 3944533 | 3944679 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 2189051 | 2189197 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 2267601 | 2267747 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 2121113 | 2121259 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 8 | 1802067 | 1802210 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2153790 | 2153933 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2287096 | 2287245 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2388445 | 2388594 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 1664780 | 1664914 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 13 | 2494469 | 2494618 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13456.8 | 1.0 | 13 | 1175 | opposite-strand | Reverse transcriptase-like |
| 2 | PF02592.17 | 0.92 | 12 | 1566.0 | opposite-strand | Putative vitamin uptake transporter |
| 3 | PF00075.26 | 1.0 | 13 | 1170.0 | opposite-strand | RNase H |
| 4 | PF02739.18 | 1.0 | 13 | 100 | same-strand | 5'-3' exonuclease, N-terminal resolvase-like domain |
| 5 | PF01367.22 | 1.0 | 13 | 100 | same-strand | 5'-3' exonuclease, C-terminal SAM fold |
| 6 | PF10752.11 | 1.0 | 13 | 76 | same-strand | Protein of unknown function (DUF2533) |
| 7 | PF00350.25 | 1.0 | 13 | 398 | same-strand | Dynamin family |
| 8 | PF01926.25 | 1.0 | 13 | 398 | same-strand | 50S ribosome-binding GTPase |
| 9 | PF04140.16 | 1.0 | 13 | 4315 | same-strand | Isoprenylcysteine carboxyl methyltransferase (ICMT) family |
| 10 | PF04191.15 | 0.77 | 10 | 4314.0 | same-strand | Phospholipid methyltransferase |
| 11 | PF00195.21 | 0.85 | 11 | 4824 | same-strand | Chalcone and stilbene synthases, N-terminal domain |
| 12 | PF02797.17 | 0.85 | 11 | 4824 | same-strand | Chalcone and stilbene synthases, C-terminal domain |
| 13 | PF08541.12 | 0.85 | 11 | 4824 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
++ More..