Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized membrane protein YoyI |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2212848 |
Right | 2213078 |
Strand | + |
Nucleotide Sequence | TTGCTAAAAGTTGCAAAAATTTCGGTTTCTTGCATTGTATTAGTCTTGTGCATATACTCATTGTTCAATCAAAATGAATTATTGTTGATTGTTGTGCAATTATTTGTTGCCGCCCTTTTATCATTAGTCGGAGTTGAAGCGATATTAAGCAAACAAAAACTGTCCGAATATTTACTGTTTGGATCAGCAGCCTTCTTACTTGTTGTAAACGGTGTGAAATTCATAATTTAA |
Sequence | MLKVAKISVSCIVLVLCIYSLFNQNELLLIVVQLFVAALLSLVGVEAILSKQKLSEYLLFGSAAFLLVVNGVKFII |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H438 |
ORF Length (Amino Acid) | 76 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2212848 | 2213078 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1786281 | 1786511 | - | NZ_CP048852.1 | Bacillus tequilensis |
3 | 2062323 | 2062553 | + | NZ_CP048852.1 | Bacillus tequilensis |
4 | 4055224 | 4055454 | - | NZ_CP029364.1 | Bacillus halotolerans |
5 | 4064397 | 4064627 | - | NZ_CP029364.1 | Bacillus halotolerans |
6 | 92834 | 93064 | + | NZ_CP029364.1 | Bacillus halotolerans |
7 | 2161081 | 2161311 | + | NZ_CP033052.1 | Bacillus vallismortis |
8 | 1986000 | 1986230 | + | NZ_CP051464.1 | Bacillus mojavensis |
9 | 1970463 | 1970693 | + | NZ_CP013984.1 | Bacillus inaquosorum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17094.7 | 0.67 | 4 | 12.5 | opposite-strand | Uncharacterised protein family (UPF0715) |
2 | PF13443.8 | 0.67 | 4 | 2519 | same-strand | Cro/C1-type HTH DNA-binding domain |