Result : C0H438

Protein Information

• Protein name: Uncharacterized membrane protein YoyI
• NCBI Accession ID: AL009126.3
• Organism: Bacillus subtilis (strain 168)
• Left: 2212848
• Right: 2213078
• Strand: +
• Nucleotide Sequence: TTGCTAAAAGTTGCAAAAATTTCGGTTTCTTGCATTGTATTAGTCTTGTGCATATACTCATTGTTCAATCAAAATGAATTATTGTTGATTGTTGTGCAATTATTTGTTGCCGCCCTTTTATCATTAGTCGGAGTTGAAGCGATATTAAGCAAACAAAAACTGTCCGAATATTTACTGTTTGGATCAGCAGCCTTCTTACTTGTTGTAAACGGTGTGAAATTCATAATTTAA
• Sequence: MLKVAKISVSCIVLVLCIYSLFNQNELLLIVVQLFVAALLSLVGVEAILSKQKLSEYLLFGSAAFLLVVNGVKFII
• Source of smORF: Swiss-Prot
• Pubmed ID: 9384377
• Functional Category: Others
• Uniprot ID: C0H438
• ORF Length (Amino Acid): 76

Conservation Analysis

No. of Species: 6

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2212848	2213078	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	1786281	1786511	-	NZ_CP048852.1	Bacillus tequilensis
3	2062323	2062553	+	NZ_CP048852.1	Bacillus tequilensis
4	4055224	4055454	-	NZ_CP029364.1	Bacillus halotolerans
5	4064397	4064627	-	NZ_CP029364.1	Bacillus halotolerans
6	92834	93064	+	NZ_CP029364.1	Bacillus halotolerans
7	2161081	2161311	+	NZ_CP033052.1	Bacillus vallismortis
8	1986000	1986230	+	NZ_CP051464.1	Bacillus mojavensis
9	1970463	1970693	+	NZ_CP013984.1	Bacillus inaquosorum

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000964.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF17094.7	0.67	4	12.5	opposite-strand	Uncharacterised protein family (UPF0715)
2	PF13443.8	0.67	4	2519	same-strand	Cro/C1-type HTH DNA-binding domain