Result : C0H433
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YoyF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2137897 |
| Right | 2138040 |
| Strand | + |
| Nucleotide Sequence | ATGATTGCTAAAATGATGGAAGCACTGGACGGAGAAAGATTTGATATCATAATGGAAAAAACGCTCAAAGGAATGACGCGTGTGATGATTTGGGGCTGTCTGCCATATTTTTTATATGTCTTGATCCGTATGTTCACAAATTAA |
| Sequence | MIAKMMEALDGERFDIIMEKTLKGMTRVMIWGCLPYFLYVLIRMFTN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H433 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2137897 | 2138040 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2080816 | 2080959 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2141568 | 2141711 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2150705 | 2150848 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 3985549 | 3985692 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 2227899 | 2228042 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 2071013 | 2071156 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1853513 | 1853656 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2097092 | 2097211 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2246200 | 2246334 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2347381 | 2347515 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 2453794 | 2453928 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01048.22 | 0.75 | 9 | 1726 | opposite-strand | Phosphorylase superfamily |
| 2 | PF01569.23 | 1.0 | 12 | 374.5 | opposite-strand | PAP2 superfamily |
| 3 | PF14162.8 | 1.0 | 12 | 122.0 | opposite-strand | YozD-like protein |
| 4 | PF06855.14 | 1.0 | 12 | 832.0 | opposite-strand | YozE SAM-like fold |
| 5 | PF14122.8 | 1.0 | 12 | 1143.0 | opposite-strand | YokU-like protein, putative antitoxin |
| 6 | PF12544.10 | 1.0 | 12 | 1418.0 | opposite-strand | Lysine-2,3-aminomutase |
| 7 | PF04055.23 | 1.0 | 12 | 1418.0 | opposite-strand | Radical SAM superfamily |
++ More..