Result : EXP04250
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04250 |
| NCBI Accession ID | NC_004663.1 |
| Organism | Bacteroides thetaiotaomicron VPI-5482 |
| Left | 3066620 |
| Right | 3066739 |
| Strand | - |
| Nucleotide Sequence | ATGGAAATATATTACATTGAAGCCGGTATCTTTGACAGGATGCTGGGATGTGTCGAAAGTCTATCGACACGCGTGGACAGGCTGTATGAGAAAAATGCGAATAAAGGGGTTGGTGAGTGA |
| Sequence | MEIYYIEAGIFDRMLGCVESLSTRVDRLYEKNANKGVGE |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 31402174 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 369366 | 369485 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 391818 | 391937 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 3 | 5996913 | 5997032 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 4 | 1606676 | 1606795 | + | NZ_LN877293.1 | Bacteroides fragilis |
| 5 | 2748147 | 2748266 | - | NC_018011.1 | Alistipes finegoldii DSM 17242 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00589.24 | 1.0 | 3 | 1806 | opposite-strand | Phage integrase family |
| 2 | PF17293.4 | 1.0 | 3 | 1806 | opposite-strand | Arm DNA-binding domain |
| 3 | PF13102.8 | 1.0 | 3 | 1806.0 | opposite-strand | Phage integrase SAM-like domain |
| 4 | PF12728.9 | 1.0 | 3 | 216.5 | same-strand | Helix-turn-helix domain |
| 5 | PF07669.13 | 0.67 | 2 | 542.0 | opposite-strand | Eco57I restriction-modification methylase |
| 6 | PF05598.13 | 0.67 | 2 | 4028.0 | same-strand | Transposase domain (DUF772) |
| 7 | PF13646.8 | 0.67 | 2 | 7352.0 | same-strand | HEAT repeats |
++ More..