Result : C0H432
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YoyE |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2136373 |
| Right | 2136498 |
| Strand | + |
| Nucleotide Sequence | ATGGGTAAAAAACATCGTAACCGGATCACCGGCCAAAAAAAGAACAATCATATACCTGAAAAAGATATCATTGCAGCTGAAGAAGCACACGGGAAAGAATATTCCGCTGCCAAACGCAAGCCTTAA |
| Sequence | MGKKHRNRITGQKKNNHIPEKDIIAAEEAHGKEYSAAKRKP |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H432 |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 23
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2136373 | 2136498 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2140039 | 2140164 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2149181 | 2149306 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2226371 | 2226496 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2079288 | 2079413 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 2069491 | 2069616 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3987090 | 3987215 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 2095531 | 2095656 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1855067 | 1855192 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2452238 | 2452369 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 2244641 | 2244772 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 2345823 | 2345954 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 3071258 | 3071383 | + | NZ_CP053989.1 | Niallia circulans |
| 14 | 3512233 | 3512379 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 15 | 1595670 | 1595816 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 16 | 1437838 | 1437963 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 17 | 2985714 | 2985839 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 18 | 1914171 | 1914296 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 19 | 1956926 | 1957048 | + | NZ_CP012024.1 | Bacillus smithii |
| 20 | 2232983 | 2233126 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 21 | 2950807 | 2950932 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 22 | 2161558 | 2161686 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 23 | 1725933 | 1726073 | - | NZ_CP016020.1 | Bacillus weihaiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03572.20 | 0.65 | 15 | 2977 | opposite-strand | Peptidase family S41 |
| 2 | PF17820.3 | 0.65 | 15 | 2977 | opposite-strand | PDZ domain |
| 3 | PF00595.26 | 0.65 | 15 | 2977 | opposite-strand | PDZ domain |
| 4 | PF13180.8 | 0.65 | 15 | 2977 | opposite-strand | PDZ domain |
| 5 | PF01471.20 | 0.65 | 15 | 2977 | opposite-strand | Putative peptidoglycan binding domain |
| 6 | PF02557.19 | 0.91 | 21 | 1004 | opposite-strand | D-alanyl-D-alanine carboxypeptidase |
| 7 | PF01048.22 | 0.91 | 21 | 203 | opposite-strand | Phosphorylase superfamily |
| 8 | PF14162.8 | 0.83 | 19 | 1120 | opposite-strand | YozD-like protein |
++ More..