Protein Information |
Information Type | Description |
---|---|
Protein name | EXP04246 |
NCBI Accession ID | NC_004663.1 |
Organism | Bacteroides thetaiotaomicron VPI-5482 |
Left | 657945 |
Right | 658085 |
Strand | + |
Nucleotide Sequence | ATGAAACAGAGAAAAGTCTTAGTAGGTATTGCTATTGCCATTTTTATTATATTATTGCTTTATTGGTTATTGGTAGCTGAAGATATGAAACCTTGGCTGTCCGCTATGGTTCCTTCAGCCTTGCAACAATTCATTGCCTGA |
Sequence | MKQRKVLVGIAIAIFIILLLYWLLVAEDMKPWLSAMVPSALQQFIA |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 31402174 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4236042 | 4236182 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
2 | 1453799 | 1453939 | - | NZ_CP012938.1 | Bacteroides ovatus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00218.23 | 1.0 | 2 | 4687.5 | opposite-strand | Indole-3-glycerol phosphate synthase |
2 | PF00591.23 | 1.0 | 2 | 3627.0 | opposite-strand | Glycosyl transferase family, a/b domain |
3 | PF02885.19 | 1.0 | 2 | 3627.0 | opposite-strand | Glycosyl transferase family, helical bundle domain |
4 | PF00117.30 | 1.0 | 2 | 3050.0 | opposite-strand | Glutamine amidotransferase class-I |
5 | PF00425.20 | 1.0 | 2 | 1592.5 | opposite-strand | chorismate binding enzyme |
6 | PF04715.15 | 1.0 | 2 | 1592.5 | opposite-strand | Anthranilate synthase component I, N terminal region |
7 | PF00291.27 | 1.0 | 2 | 360.0 | opposite-strand | Pyridoxal-phosphate dependent enzyme |
8 | PF00465.21 | 1.0 | 2 | 79.0 | same-strand | Iron-containing alcohol dehydrogenase |
9 | PF02518.28 | 1.0 | 2 | 1349.0 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
10 | PF00512.27 | 1.0 | 2 | 1349.0 | opposite-strand | His Kinase A (phospho-acceptor) domain |
11 | PF03600.18 | 1.0 | 2 | 3314.5 | same-strand | Citrate transporter |
12 | PF02080.23 | 1.0 | 2 | 3314.5 | same-strand | TrkA-C domain |