Result : EXP04245
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04245 |
| NCBI Accession ID | NC_004663.1 |
| Organism | Bacteroides thetaiotaomicron VPI-5482 |
| Left | 6256915 |
| Right | 6257022 |
| Strand | + |
| Nucleotide Sequence | ATGGAGTTCAAATCATTAAAAAACATCGAGACATCGTTCCGGCAGCTACGGCTGTTCGGAATGGTATTCCTGGGAGTATGCGTACTGGTAACGGTCTTTGCCACCTGA |
| Sequence | MEFKSLKNIETSFRQLRLFGMVFLGVCVLVTVFAT |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 31402174 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3558276 | 3558383 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 2755229 | 2755336 | + | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07863.13 | 1.0 | 2 | 28.0 | same-strand | Homologues of TraJ from Bacteroides conjugative transposon |
| 2 | PF13595.8 | 1.0 | 2 | 2050.0 | same-strand | Domain of unknown function (DUF4138) |
| 3 | PF10626.11 | 1.0 | 2 | 2968.0 | same-strand | Conjugative transposon protein TraO |
++ More..