Result : EXP04244
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04244 |
| NCBI Accession ID | NC_004663.1 |
| Organism | Bacteroides thetaiotaomicron VPI-5482 |
| Left | 2419715 |
| Right | 2419858 |
| Strand | + |
| Nucleotide Sequence | ATGACGATAATTAAACGTAAAACGTTTATAATTAAGCATTTTGCGAGAATTGCAGAACAGACAGACCTGCAAAAGAAAACAAAATATTGCGACGTTTCAGTTACCAGACTGTTAGCCGCCTGTTTCGGAAACGACGGCAGGTAA |
| Sequence | MTIIKRKTFIIKHFARIAEQTDLQKKTKYCDVSVTRLLAACFGNDGR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 31402174 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5993622 | 5993765 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 1609943 | 1610086 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 3 | 2744856 | 2744999 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00589.24 | 1.0 | 3 | 113.0 | same-strand | Phage integrase family |
| 2 | PF13102.8 | 1.0 | 3 | 594 | same-strand | Phage integrase SAM-like domain |
| 3 | PF17293.4 | 1.0 | 3 | 594 | same-strand | Arm DNA-binding domain |
| 4 | PF12728.9 | 1.0 | 3 | 2638 | opposite-strand | Helix-turn-helix domain |
| 5 | PF07669.13 | 0.67 | 2 | 3809.0 | same-strand | Eco57I restriction-modification methylase |
++ More..