Result : EXP04243
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04243 |
| NCBI Accession ID | NC_004663.1 |
| Organism | Bacteroides thetaiotaomicron VPI-5482 |
| Left | 190984 |
| Right | 191109 |
| Strand | + |
| Nucleotide Sequence | ATGTTTGGAATAGATGACCCTTTTATAGTCTTGCCATATATCCTCTCAGTGATATGTGTGATTTTTGCTGCCTGGTTTGGGCTGAAATATTGGAATAAGGACGACGATAAAGACGAAACGCGATGA |
| Sequence | MFGIDDPFIVLPYILSVICVIFAAWFGLKYWNKDDDKDETR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 31402174 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3769080 | 3769205 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 102828 | 102953 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 3458174 | 3458299 | - | NZ_LN877293.1 | Bacteroides fragilis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04893.19 | 1.0 | 3 | 3983 | same-strand | Yip1 domain |
| 2 | PF01668.20 | 1.0 | 3 | 3521 | same-strand | SmpB protein |
| 3 | PF02574.18 | 1.0 | 3 | 684 | same-strand | Homocysteine S-methyltransferase |
| 4 | PF00809.24 | 1.0 | 3 | 684 | same-strand | Pterin binding enzyme |
| 5 | PF02607.19 | 1.0 | 3 | 684 | same-strand | B12 binding domain |
| 6 | PF00474.19 | 1.0 | 3 | -3 | same-strand | Sodium:solute symporter family |
| 7 | PF01464.22 | 1.0 | 3 | 1610 | opposite-strand | Transglycosylase SLT domain |
| 8 | PF00497.22 | 1.0 | 3 | 1610 | opposite-strand | Bacterial extracellular solute-binding proteins, family 3 |
| 9 | PF00485.20 | 1.0 | 3 | 2998 | opposite-strand | Phosphoribulokinase / Uridine kinase family |
| 10 | PF13238.8 | 1.0 | 3 | 2998 | opposite-strand | AAA domain |
| 11 | PF07876.14 | 1.0 | 3 | 3717 | same-strand | Stress responsive A/B Barrel Domain |
| 12 | PF02683.17 | 1.0 | 3 | 4082 | same-strand | Cytochrome C biogenesis protein transmembrane region |
| 13 | PF11412.10 | 1.0 | 3 | 4082 | same-strand | Disulphide bond corrector protein DsbC |
| 14 | PF13386.8 | 1.0 | 3 | 4082 | same-strand | Cytochrome C biogenesis protein transmembrane region |
++ More..