| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YoyD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2130177 |
| Right | 2130377 |
| Strand | + |
| Nucleotide Sequence | ATGGTTAAAAAAGCACTTATTGTTATTCTCATTCTTTTGCCATTCGTTCAGCTCGCGCTTTTGCCGCTTGTGAATCGAATAGAACCGATTATGTTCGGCCTGCCGTTTTTCCACTTTTGGCTGCTGCTGTGGATTATTGTTACGCCGTTATGCTCGTTTGGCATTTATCAGATGCAAAAAAAAGATGGAGGACTTGAATAA |
| Sequence | MVKKALIVILILLPFVQLALLPLVNRIEPIMFGLPFFHFWLLLWIIVTPLCSFGIYQMQKKDGGLE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11755. Profile Description: Protein of unknown function (DUF3311). This is a family of short bacterial proteins of unknown function. |
| Pubmed ID | 9384377 |
| Domain | CDD:403070 |
| Functional Category | Others |
| Uniprot ID | C0H431 |
| ORF Length (Amino Acid) | 66 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2130177 | 2130377 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2220162 | 2220362 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 2133830 | 2134030 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2073078 | 2073278 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 2142984 | 2143184 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 3993190 | 3993390 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2063314 | 2063514 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1865197 | 1865397 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2085311 | 2085511 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3410431 | 3410634 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 1968891 | 1969109 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 3319252 | 3319455 | - | NZ_CP043404.1 | Bacillus safensis |
| 13 | 2337735 | 2337911 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 2235242 | 2235445 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 335416 | 335592 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01638.19 | 0.93 | 14 | 2506.0 | opposite-strand | HxlR-like helix-turn-helix |
| 2 | PF00881.26 | 0.93 | 14 | 1756.0 | same-strand | Nitroreductase family |
| 3 | PF02230.18 | 0.73 | 11 | 1111 | opposite-strand | Phospholipase/Carboxylesterase |
| 4 | PF00474.19 | 1.0 | 15 | 0 | same-strand | Sodium:solute symporter family |
| 5 | PF03572.20 | 0.93 | 14 | 1526.0 | opposite-strand | Peptidase family S41 |
| 6 | PF17820.3 | 0.93 | 14 | 1526.0 | opposite-strand | PDZ domain |
| 7 | PF00595.26 | 0.93 | 14 | 1526.0 | opposite-strand | PDZ domain |
| 8 | PF13180.8 | 0.93 | 14 | 1526.0 | opposite-strand | PDZ domain |
| 9 | PF01471.20 | 0.93 | 14 | 1526.0 | opposite-strand | Putative peptidoglycan binding domain |
| 10 | PF08241.14 | 0.8 | 12 | 3078.5 | same-strand | Methyltransferase domain |
| 11 | PF13649.8 | 0.8 | 12 | 3078.5 | same-strand | Methyltransferase domain |
| 12 | PF13847.8 | 0.67 | 10 | 3078.0 | same-strand | Methyltransferase domain |
| 13 | PF13489.8 | 0.73 | 11 | 3078 | same-strand | Methyltransferase domain |
| 14 | PF08242.14 | 0.8 | 12 | 3078.5 | same-strand | Methyltransferase domain |
| 15 | PF02557.19 | 0.73 | 11 | 4189 | opposite-strand | D-alanyl-D-alanine carboxypeptidase |