Result : C0H429
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YoyB |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2098102 |
| Right | 2098329 |
| Strand | + |
| Nucleotide Sequence | ATGCTTCCGACTAACATCAATATTTCTCATCTCAAGACTAACTCGATAGGCACCGGCTCATCCCTTACCTTTGGTTCTGCGGAGTTAAGGAACAGGTGCTCTGCTATCAAAAGAAATAACGGTTTTGGGGAACAAAATGCAGATGGTATTGTTATGGTCATTCCGATTGAATCAATTGATGACCGTGATGTGTCAGATGCACTCAGTATGAAAATCAATCATCAATAA |
| Sequence | MLPTNINISHLKTNSIGTGSSLTFGSAELRNRCSAIKRNNGFGEQNADGIVMVIPIESIDDRDVSDALSMKINHQ |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H429 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2098102 | 2098329 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2113165 | 2113392 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 785544 | 785771 | - | NZ_CP043404.1 | Bacillus safensis |
| 4 | 716756 | 716983 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 5 | 891133 | 891360 | - | NZ_CP017786.1 | Bacillus xiamenensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP043404.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00011.23 | 1.0 | 5 | -19 | opposite-strand | Hsp20/alpha crystallin family |
| 2 | PF17886.3 | 1.0 | 5 | -19 | opposite-strand | HSP20-like domain found in ArsA |
| 3 | PF10676.11 | 1.0 | 5 | 790 | same-strand | Spore germination protein gerPA/gerPF |
| 4 | PF13704.8 | 0.6 | 3 | 2632 | opposite-strand | Glycosyl transferase family 2 |
| 5 | PF13520.8 | 0.6 | 3 | 1060 | opposite-strand | Amino acid permease |
| 6 | PF00324.23 | 0.6 | 3 | 1060 | opposite-strand | Amino acid permease |
| 7 | PF13906.8 | 0.6 | 3 | 1060 | opposite-strand | C-terminus of AA permease |
| 8 | PF00939.21 | 0.6 | 3 | 428 | same-strand | Sodium:sulfate symporter transmembrane region |
| 9 | PF03600.18 | 0.6 | 3 | 428 | same-strand | Citrate transporter |
| 10 | PF00905.24 | 0.6 | 3 | 2109 | opposite-strand | Penicillin binding protein transpeptidase domain |
| 11 | PF03717.17 | 0.6 | 3 | 2109 | opposite-strand | Penicillin-binding Protein dimerisation domain |
| 12 | PF05223.13 | 0.6 | 3 | 2109 | opposite-strand | NTF2-like N-terminal transpeptidase domain |
| 13 | PF07690.18 | 0.6 | 3 | 4294 | opposite-strand | Major Facilitator Superfamily |
++ More..