Protein Information |
Information Type | Description |
---|---|
Protein name | EXP04222 |
NCBI Accession ID | NZ_CP027540.1 |
Organism | S. pneumoniae D39V |
Left | 1404509 |
Right | 1404604 |
Strand | - |
Nucleotide Sequence | CTGGCAGAAACCTGTGATAGTGTCGTCATTCCGAATTTTATGCTGAAAAGTATGCTTTCCGGCCCTATCTTAAACAGCGAGACTTGTTATGATTAA |
Sequence | LAETCDSVVIPNFMLKSMLSGPILNSETCYD |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 35852327 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 31 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1107337 | 1107417 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
2 | 1055113 | 1055193 | - | NZ_LR134275.1 | Streptococcus vestibularis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03462.20 | 1.0 | 2 | 5883.5 | same-strand | PCRF domain |
2 | PF00472.22 | 1.0 | 2 | 5883.5 | same-strand | RF-1 domain |
3 | PF08331.12 | 1.0 | 2 | 4621.5 | same-strand | Domain of unknown function (DUF1730) |
4 | PF13484.8 | 1.0 | 2 | 4621.5 | same-strand | 4Fe-4S double cluster binding domain |
5 | PF00149.30 | 1.0 | 2 | 3643.5 | opposite-strand | Calcineurin-like phosphoesterase |
6 | PF00881.26 | 1.0 | 2 | 2872.5 | same-strand | Nitroreductase family |
7 | PF00122.22 | 1.0 | 2 | 79.0 | same-strand | E1-E2 ATPase |
8 | PF00689.23 | 1.0 | 2 | 79.0 | same-strand | Cation transporting ATPase, C-terminus |
9 | PF00702.28 | 1.0 | 2 | 79.0 | same-strand | haloacid dehalogenase-like hydrolase |
10 | PF00690.28 | 1.0 | 2 | 79.0 | same-strand | Cation transporter/ATPase, N-terminus |
11 | PF13246.8 | 1.0 | 2 | 79.0 | same-strand | Cation transport ATPase (P-type) |
12 | PF09148.12 | 1.0 | 2 | 100.5 | same-strand | Domain of unknown function (DUF1934) |
13 | PF13508.9 | 1.0 | 2 | 570.0 | same-strand | Acetyltransferase (GNAT) domain |
14 | PF08282.14 | 1.0 | 2 | 1634.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
15 | PF02388.18 | 1.0 | 2 | 2445.0 | opposite-strand | FemAB family |