Result : EXP04222
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04222 |
| NCBI Accession ID | NZ_CP027540.1 |
| Organism | S. pneumoniae D39V |
| Left | 1404509 |
| Right | 1404604 |
| Strand | - |
| Nucleotide Sequence | CTGGCAGAAACCTGTGATAGTGTCGTCATTCCGAATTTTATGCTGAAAAGTATGCTTTCCGGCCCTATCTTAAACAGCGAGACTTGTTATGATTAA |
| Sequence | LAETCDSVVIPNFMLKSMLSGPILNSETCYD |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 35852327 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1107337 | 1107417 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 2 | 1055113 | 1055193 | - | NZ_LR134275.1 | Streptococcus vestibularis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017581.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03462.20 | 1.0 | 2 | 5883.5 | same-strand | PCRF domain |
| 2 | PF00472.22 | 1.0 | 2 | 5883.5 | same-strand | RF-1 domain |
| 3 | PF08331.12 | 1.0 | 2 | 4621.5 | same-strand | Domain of unknown function (DUF1730) |
| 4 | PF13484.8 | 1.0 | 2 | 4621.5 | same-strand | 4Fe-4S double cluster binding domain |
| 5 | PF00149.30 | 1.0 | 2 | 3643.5 | opposite-strand | Calcineurin-like phosphoesterase |
| 6 | PF00881.26 | 1.0 | 2 | 2872.5 | same-strand | Nitroreductase family |
| 7 | PF00122.22 | 1.0 | 2 | 79.0 | same-strand | E1-E2 ATPase |
| 8 | PF00689.23 | 1.0 | 2 | 79.0 | same-strand | Cation transporting ATPase, C-terminus |
| 9 | PF00702.28 | 1.0 | 2 | 79.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 10 | PF00690.28 | 1.0 | 2 | 79.0 | same-strand | Cation transporter/ATPase, N-terminus |
| 11 | PF13246.8 | 1.0 | 2 | 79.0 | same-strand | Cation transport ATPase (P-type) |
| 12 | PF09148.12 | 1.0 | 2 | 100.5 | same-strand | Domain of unknown function (DUF1934) |
| 13 | PF13508.9 | 1.0 | 2 | 570.0 | same-strand | Acetyltransferase (GNAT) domain |
| 14 | PF08282.14 | 1.0 | 2 | 1634.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 15 | PF02388.18 | 1.0 | 2 | 2445.0 | opposite-strand | FemAB family |
++ More..