Result : EXP04204
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04204 |
| NCBI Accession ID | NZ_CP027540.1 |
| Organism | S. pneumoniae D39V |
| Left | 141806 |
| Right | 141937 |
| Strand | + |
| Nucleotide Sequence | ATGAGTTGGTTAGACGCTTTTCATTATAGGTCATATGGGGCTTTTTTCTACAAGAAACGACCCTATAATTCCTGGGGTGGGATTACCCACTACAGAAATTATAGAGCCAAAGCATTCCAAAGTCTTGTCTGA |
| Sequence | MSWLDAFHYRSYGAFFYKKRPYNSWGGITHYRNYRAKAFQSLV |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 35852327 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 707373 | 707480 | + | NZ_LT906439.1 | Streptococcus merionis |
| 2 | 1613727 | 1613834 | - | NZ_LT906439.1 | Streptococcus merionis |
| 3 | 1818922 | 1819029 | - | NZ_LT906439.1 | Streptococcus merionis |
| 4 | 1921740 | 1921847 | - | NZ_LT906439.1 | Streptococcus merionis |
| 5 | 614388 | 614495 | + | NZ_LT906439.1 | Streptococcus merionis |
| 6 | 1715844 | 1715951 | + | NZ_LT906439.1 | Streptococcus merionis |
| 7 | 1915912 | 1916052 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 8 | 894182 | 894295 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 9 | 404998 | 405114 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 10 | 1114536 | 1114679 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 11 | 1472936 | 1473067 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 12 | 1923140 | 1923265 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 13 | 1045821 | 1045958 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 14 | 508391 | 508525 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 15 | 100578 | 100703 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 16 | 1403231 | 1403359 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 17 | 2121913 | 2122032 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 18 | 1262510 | 1262623 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 19 | 1663849 | 1663962 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 20 | 534903 | 535019 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 21 | 1519965 | 1520108 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 22 | 2146379 | 2146504 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 23 | 1016633 | 1016758 | - | NZ_CP010450.1 | Streptococcus pyogenes |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906439.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01610.19 | 0.6 | 3 | 14.0 | opposite-strand | Transposase |
| 2 | PF14690.8 | 0.6 | 3 | 14.0 | opposite-strand | zinc-finger of transposase IS204/IS1001/IS1096/IS1165 |
++ More..