Result : C0H423
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YozV |
| NCBI Accession ID | GQ845010.2 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1 |
| Right | 240 |
| Strand | + |
| Nucleotide Sequence | ATGGTAAGCAAGAAGAACAAAATTGTAGCGGCATTATTAGCATTTTTCTTCGGGGGTCTGGGAATACATAAGTTTTATTTGGGAAGAGTAGGACAAGGTATTCTATATATTTTGTTTTGCTGGACTGGTATTCCGTCTATTATCGCATTTATTGAATTCATTATTTTTCTTTGTGGAAGCGAAGAAGGGTTTGATCAAAAGTACAATTTTTATTACTTTCAGCAGCAATCTAAAGCTTAA |
| Sequence | MVSKKNKIVAALLAFFFGGLGIHKFYLGRVGQGILYILFCWTGIPSIIAFIEFIIFLCGSEEGFDQKYNFYYFQQQSKA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00984. Profile Description: TM2 domain. TM2 domain-containing protein |
| Pubmed ID | 9384377 |
| Domain | CDD:382321 |
| Functional Category | Others |
| Uniprot ID | C0H423 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2055868 | 2056107 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 139333 | 139539 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 3 | 2456829 | 2457041 | - | NZ_CP026364.1 | Proteus hauseri |
| 4 | 1607484 | 1607708 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 5 | 4036709 | 4036951 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 6 | 1111748 | 1111990 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 7 | 3776328 | 3776579 | + | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 8 | 1501918 | 1502157 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 9 | 2058667 | 2058903 | + | NZ_CP014945.1 | Psychrobacter alimentarius |
| 10 | 3440513 | 3440755 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 11 | 1872536 | 1872778 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 12 | 1189508 | 1189750 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 13 | 1249887 | 1250087 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 14 | 2165213 | 2165407 | - | NZ_AP018933.1 | Zymobacter palmae |
| 15 | 4503955 | 4504173 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 16 | 292101 | 292313 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 17 | 3401899 | 3402114 | + | NZ_LR134289.1 | Chryseobacterium gleum |
| 18 | 2181079 | 2181291 | + | NZ_CP029463.1 | Flavobacterium sediminis |
| 19 | 4075998 | 4076216 | - | NZ_CP071320.1 | Serratia ureilytica |
| 20 | 4819764 | 4820006 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 21 | 291826 | 292044 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 22 | 3283703 | 3283918 | - | NZ_CP009515.1 | Methanosarcina lacustris Z-7289 |
| 23 | 3103304 | 3103519 | + | NZ_CP033926.1 | Chryseobacterium joostei |
| 24 | 2004148 | 2004378 | - | NZ_CP082286.1 | Halobaculum roseum |
| 25 | 1744975 | 1745202 | + | NZ_CP009516.1 | Methanosarcina horonobensis HB-1 = JCM 15518 |
| 26 | 2361647 | 2361862 | + | NZ_CP040449.1 | Aeromonas simiae |
| 27 | 967324 | 967542 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 28 | 837260 | 837472 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 29 | 3264240 | 3264458 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 30 | 431290 | 431505 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 31 | 743417 | 743668 | - | NZ_CP058529.1 | Halobaculum halophilum |
| 32 | 2618818 | 2619078 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 33 | 2042256 | 2042486 | - | NZ_CP081958.1 | Halobaculum magnesiiphilum |
| 34 | 1081048 | 1081266 | + | NZ_LT906479.1 | Serratia ficaria |
| 35 | 777464 | 777670 | - | NZ_CP016540.2 | Planococcus versutus |
| 36 | 2852368 | 2852565 | - | NZ_CP022986.1 | Chryseobacterium camelliae |
| 37 | 756923 | 757129 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 38 | 767190 | 767384 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 39 | 13258 | 13452 | + | NZ_CP012678.1 | Psychrobacter urativorans |
| 40 | 942988 | 943194 | + | NZ_CP013661.2 | Planococcus kocurii |
| 41 | 829259 | 829465 | - | NZ_CP019401.1 | Planococcus faecalis |
| 42 | 922587 | 922844 | + | NZ_CP053015.1 | Sphingomonas lacunae |
| 43 | 2462428 | 2462661 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 44 | 3825364 | 3825561 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
| 45 | 881647 | 881883 | + | NZ_CP060092.1 | Teredinibacter purpureus |
++ More..