Result : C0H419
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Biotin/lipoyl attachment protein (BLAP) |
| NCBI Accession ID | AF184956.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 46118 |
| Right | 46339 |
| Strand | + |
| Nucleotide Sequence | ATGACGGTTATTATACAAATGGCGGGCAACCTGTGGAAAGTGCACGTTAAAGCCGGCGACCACATTGAAAAAGGCCAGGAAGTTGCCATTTTGGAATCAATGAAAATGGAAATCCCGATCGTTGCGGACAGAAGCGGAACCGTAAAAGAAGTCAAAAAAAACGAAGGCGATTTTGTGAATGAAGGTGACGTGTTGCTCGAATTGAGCGATTCCACTCAATAA |
| Sequence | MTVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11404. Profile Description: N/A. HlyD_D4 is the long alpha-hairpin domain in the centre of CusB or HlyD proteins. CusB and HlyD proteins are membrane fusion proteins of the CusCFBA copper efflux system in E.coli and related bacteria. Efflux systems of this resistance-nodulation-division group - RND - have been developed to excrete poisonous metal ions, and in E.coli the only one that deals with silver and copper is the CusA transporter. The transporter CusA works in conjunction with a periplasmic component that is a membrane fusion protein, eg CusB, and an outer-membrane channel component CusC in a CusABC complex driven by import of protons. HlyD_D4 is thought to interact with the alpha-helical tunnels of the corresponding outer-membrane channels, ie the periplasmic domain of CusC. |
| Pubmed ID | 10557314 9384377 16699181 |
| Domain | CDD:416260 |
| Functional Category | Others |
| Uniprot ID | C0H419 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 124
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1952945 | 1953166 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1897971 | 1898192 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1916053 | 1916274 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2065983 | 2066201 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1962387 | 1962608 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 15000 | 15221 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1882263 | 1882484 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1991778 | 1991969 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1961363 | 1961554 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2090997 | 2091176 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2144669 | 2144848 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 1854664 | 1854858 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 2218683 | 2218874 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 3506094 | 3506288 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 3434254 | 3434436 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 1441893 | 1442084 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 17 | 2966194 | 2966385 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 18 | 3180642 | 3180836 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 19 | 2004699 | 2004890 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 20 | 1822456 | 1822647 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 21 | 1631220 | 1631411 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 22 | 2836412 | 2836603 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 23 | 810261 | 810452 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 24 | 1110857 | 1111048 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 25 | 1951106 | 1951315 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 26 | 2307737 | 2307928 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 27 | 509968 | 510159 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 28 | 1749653 | 1749844 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 29 | 146786 | 146977 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 30 | 178574 | 178765 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 31 | 3704103 | 3704312 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 32 | 863985 | 864176 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 33 | 1949939 | 1950130 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 34 | 3230203 | 3230385 | + | NZ_CP021434.1 | Tumebacillus avium |
| 35 | 1711061 | 1711252 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 36 | 2725283 | 2725474 | - | NZ_CP040336.1 | Bacillus luti |
| 37 | 2373047 | 2373238 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 38 | 2502937 | 2503128 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 39 | 1724971 | 1725180 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 40 | 2415935 | 2416126 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 41 | 2433282 | 2433473 | + | NC_011725.1 | Bacillus cereus B4264 |
| 42 | 1619544 | 1619735 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 43 | 1866739 | 1866930 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 44 | 1606393 | 1606596 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 45 | 2375569 | 2375760 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 46 | 2618275 | 2618469 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 47 | 1739339 | 1739548 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 48 | 1914787 | 1914978 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 49 | 2277046 | 2277237 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 50 | 3156051 | 3156242 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 51 | 1867245 | 1867436 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 52 | 2161814 | 2162005 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 53 | 2104147 | 2104329 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 54 | 2398949 | 2399140 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 55 | 3601724 | 3601915 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 56 | 874166 | 874348 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 57 | 1104666 | 1104857 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 58 | 1696310 | 1696501 | - | NZ_CP034118.1 | Staphylospora marina |
| 59 | 3552271 | 3552462 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 60 | 902257 | 902451 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 61 | 878615 | 878818 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 62 | 1004531 | 1004722 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 63 | 2740413 | 2740604 | - | NZ_CP012024.1 | Bacillus smithii |
| 64 | 5093062 | 5093253 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 65 | 2656075 | 2656266 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 66 | 1571133 | 1571324 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 67 | 1470579 | 1470770 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 68 | 5599866 | 5600057 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 69 | 4211244 | 4211435 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 70 | 1605411 | 1605605 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 71 | 1612770 | 1612964 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 72 | 1390908 | 1391087 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 73 | 4377352 | 4377543 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 74 | 458788 | 458979 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 75 | 1662508 | 1662702 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 76 | 600628 | 600834 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 77 | 3910173 | 3910364 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 78 | 630373 | 630564 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 79 | 281829 | 282011 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 80 | 3337079 | 3337303 | + | NZ_CP065534.1 | Lonsdalea populi |
| 81 | 3389524 | 3389715 | - | NZ_AP014924.1 | Limnochorda pilosa |
| 82 | 7669934 | 7670113 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 83 | 2320810 | 2320995 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 84 | 1252024 | 1252206 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 85 | 2156026 | 2156217 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 86 | 3365913 | 3366092 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
| 87 | 1966175 | 1966366 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 88 | 5053491 | 5053682 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 89 | 239522 | 239713 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 90 | 1877509 | 1877700 | - | NC_008553.1 | Methanothrix thermoacetophila PT |
| 91 | 4073322 | 4073513 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 92 | 3085988 | 3086176 | - | NZ_CP014226.1 | Halomonas chromatireducens |
| 93 | 2656860 | 2657051 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 94 | 2356176 | 2356367 | + | NZ_CP026363.1 | Brevibacillus agri |
| 95 | 1665281 | 1665472 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 96 | 1691026 | 1691217 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 97 | 205944 | 206135 | + | NZ_CP018804.1 | Histophilus somni |
| 98 | 1292509 | 1292700 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 99 | 711305 | 711511 | + | NZ_CP013106.1 | Halomonas huangheensis |
| 100 | 8551170 | 8551358 | + | NZ_AP022870.1 | Phytohabitans flavus |
| 101 | 1910906 | 1911109 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 102 | 1729031 | 1729234 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 103 | 2706593 | 2706784 | - | NZ_CP051183.1 | Bermanella marisrubri |
| 104 | 4106940 | 4107131 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 105 | 759747 | 759956 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 106 | 4553396 | 4553587 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 107 | 2576849 | 2577052 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
| 108 | 1334976 | 1335167 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 109 | 1395119 | 1395310 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 110 | 3362803 | 3363021 | + | NZ_CP013290.1 | Janibacter indicus |
| 111 | 2283497 | 2283688 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 112 | 2168816 | 2169019 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 113 | 2494252 | 2494455 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 114 | 4488355 | 4488546 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 115 | 1674773 | 1674964 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 116 | 4362399 | 4362590 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 117 | 1425828 | 1426019 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 118 | 315636 | 315827 | + | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 119 | 1074895 | 1075104 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 120 | 1571626 | 1571817 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 121 | 2752283 | 2752474 | - | NZ_LS483476.1 | Lederbergia lentus |
| 122 | 2387444 | 2387635 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 123 | 1590582 | 1590773 | + | NC_013849.1 | Ferroglobus placidus DSM 10642 |
| 124 | 1433739 | 1433930 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 125 | 656508 | 656705 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 126 | 2871638 | 2871829 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 127 | 1642222 | 1642428 | - | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 128 | 429732 | 429923 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 129 | 155097 | 155288 | + | NZ_AP019829.2 | Leptotrichia wadei |
| 130 | 1114984 | 1115175 | - | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 131 | 6247729 | 6247944 | - | NZ_CP012159.1 | Chondromyces crocatus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01039.24 | 0.72 | 89 | 1729 | same-strand | Carboxyl transferase domain |
| 2 | PF00378.22 | 0.69 | 85 | 938 | same-strand | Enoyl-CoA hydratase/isomerase |
| 3 | PF02786.19 | 0.66 | 82 | 43 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 4 | PF00289.24 | 0.66 | 82 | 43 | same-strand | Biotin carboxylase, N-terminal domain |
| 5 | PF02785.21 | 0.66 | 82 | 43.0 | same-strand | Biotin carboxylase C-terminal domain |
| 6 | PF02222.24 | 0.63 | 78 | 43.5 | same-strand | ATP-grasp domain |
++ More..