Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YnzL |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1930074 |
Right | 1930199 |
Strand | + |
Nucleotide Sequence | GTGAAGAAGATGAGAAAACGTTCTTTTCATGAGCTCGTCATGGAAAACAAAAAAGAGCTGATGACCAATACAGAGTATTTAAATCAGCTTGAGGAAAAGCTTGAACAGCGATTTAAGCAAAAATAA |
Sequence | MKKMRKRSFHELVMENKKELMTNTEYLNQLEEKLEQRFKQK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl16047. Profile Description: Fur-regulated basic protein B. This model describes FbpB (Fur-regulated basic protein B), one of three paralogous small proteins recognized by Pfam model PF13040 in Bacillus subtilis. |
Pubmed ID | 9384377 |
Domain | CDD:387731 |
Functional Category | Others |
Uniprot ID | C0H418 |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1838387 | 1838512 | + | NZ_CP013984.1 | Bacillus inaquosorum |
2 | 1893960 | 1894085 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 1930074 | 1930199 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
4 | 1892154 | 1892279 | + | NZ_CP048852.1 | Bacillus tequilensis |
5 | 40193 | 40318 | - | NZ_CP029364.1 | Bacillus halotolerans |
6 | 1857281 | 1857406 | + | NZ_CP051464.1 | Bacillus mojavensis |
7 | 1879126 | 1879251 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
8 | 2076580 | 2076705 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 2043047 | 2043172 | + | NZ_CP033052.1 | Bacillus vallismortis |
10 | 3546161 | 3546286 | - | NZ_CP017786.1 | Bacillus xiamenensis |
11 | 1779525 | 1779650 | + | NZ_CP011150.1 | Bacillus altitudinis |
12 | 3536143 | 3536268 | - | NZ_CP043404.1 | Bacillus safensis |
13 | 2039996 | 2040121 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
14 | 1989412 | 1989537 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
15 | 2172582 | 2172707 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
16 | 1445363 | 1445494 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
17 | 2167850 | 2167981 | - | NZ_CP016020.1 | Bacillus weihaiensis |
18 | 2432604 | 2432735 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
19 | 2621031 | 2621162 | + | NZ_CP053989.1 | Niallia circulans |
20 | 2179658 | 2179786 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
21 | 1026647 | 1026775 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
22 | 4999559 | 4999687 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF08179.14 | 0.68 | 15 | 3796 | opposite-strand | Small acid-soluble spore protein P family |
2 | PF08175.14 | 0.68 | 15 | 3614 | opposite-strand | Small acid-soluble spore protein O family |
3 | PF00330.22 | 0.86 | 19 | 662 | same-strand | Aconitase family (aconitate hydratase) |
4 | PF00694.21 | 0.86 | 19 | 662 | same-strand | Aconitase C-terminal domain |
5 | PF00578.23 | 0.95 | 21 | 80 | same-strand | AhpC/TSA family |
6 | PF08534.12 | 0.95 | 21 | 80 | same-strand | Redoxin |
7 | PF13905.8 | 0.95 | 21 | 80 | same-strand | Thioredoxin-like |
8 | PF13098.8 | 0.91 | 20 | 79.5 | same-strand | Thioredoxin-like domain |
9 | PF08177.13 | 1.0 | 22 | 65.0 | same-strand | Small acid-soluble spore protein N family |
10 | PF19824.1 | 0.86 | 19 | 246 | same-strand | Small, acid-soluble spore protein Tlp |
11 | PF03061.24 | 0.95 | 21 | 583 | same-strand | Thioesterase superfamily |
12 | PF13279.8 | 0.95 | 21 | 583 | same-strand | Thioesterase-like superfamily |