| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04157 |
| NCBI Accession ID | NZ_CP027540.1 |
| Organism | S. pneumoniae D39V |
| Left | 78879 |
| Right | 78992 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATCAAAGATCAAACTAGGAAACTAGCTACGGGCTGCTCAAAACACTGTTTTGAGGTTGCAGATAGAACTGACGAAGTCAGTAACATCTATACGGCAAGGCGACGTTGA |
| Sequence | MKIKDQTRKLATGCSKHCFEVADRTDEVSNIYTARRR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 35852327 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 37 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1453672 | 1453785 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 2 | 536649 | 536762 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 3 | 2064128 | 2064241 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 4 | 104323 | 104436 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 5 | 1271423 | 1271536 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 6 | 1532946 | 1533059 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 7 | 569977 | 570093 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 8 | 1218245 | 1218349 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 9 | 161254 | 161358 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 10 | 1591521 | 1591616 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 11 | 1838261 | 1838374 | + | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 12 | 1491809 | 1491922 | + | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 13 | 1779994 | 1780107 | + | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 14 | 1430905 | 1431018 | + | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 15 | 1614084 | 1614191 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 16 | 1023905 | 1024018 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 17 | 390608 | 390721 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 18 | 401537 | 401662 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 19 | 238050 | 238154 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 20 | 545793 | 545897 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 21 | 1765515 | 1765616 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 1.0 | 3 | 2252 | opposite-strand | ABC transporter |
| 2 | PF12848.9 | 0.67 | 2 | 4036.5 | both-strands | ABC transporter |
| 3 | PF04650.19 | 0.67 | 2 | 1554.0 | opposite-strand | YSIRK type signal peptide |
| 4 | PF07501.14 | 0.67 | 2 | 1835 | same-strand | G5 domain |
| 5 | PF04851.17 | 0.67 | 2 | 32.0 | opposite-strand | Type III restriction enzyme, res subunit |
| 6 | PF00270.31 | 0.67 | 2 | 32.0 | opposite-strand | DEAD/DEAH box helicase |
| 7 | PF00664.25 | 0.67 | 2 | 1781 | opposite-strand | ABC transporter transmembrane region |
| 8 | PF02517.18 | 0.67 | 2 | 3836 | opposite-strand | Type II CAAX prenyl endopeptidase Rce1-like |
| 9 | PF00208.23 | 0.67 | 2 | 1271.0 | opposite-strand | Glutamate/Leucine/Phenylalanine/Valine dehydrogenase |
| 10 | PF02812.20 | 0.67 | 2 | 1271.0 | opposite-strand | Glu/Leu/Phe/Val dehydrogenase, dimerisation domain |
| 11 | PF03372.25 | 0.67 | 2 | 1143.5 | both-strands | Endonuclease/Exonuclease/phosphatase family |
| 12 | PF00132.26 | 0.67 | 2 | 4476.0 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 13 | PF00156.29 | 0.67 | 2 | 2056.0 | opposite-strand | Phosphoribosyl transferase domain |
| 14 | PF00730.27 | 0.67 | 2 | 1216.0 | opposite-strand | HhH-GPD superfamily base excision DNA repair protein |
| 15 | PF00633.25 | 0.67 | 2 | 1216.0 | opposite-strand | Helix-hairpin-helix motif |
| 16 | PF02620.19 | 0.67 | 2 | 674.0 | opposite-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 17 | PF01435.20 | 0.67 | 2 | 1755.5 | opposite-strand | Peptidase family M48 |
| 18 | PF04011.14 | 0.67 | 2 | 2656.5 | opposite-strand | LemA family |
| 19 | PF02527.17 | 0.67 | 2 | 3310.5 | same-strand | rRNA small subunit methyltransferase G |
| 20 | PF13847.8 | 0.67 | 2 | 3310.5 | same-strand | Methyltransferase domain |
| 21 | PF00860.22 | 0.67 | 2 | 4252.5 | same-strand | Permease family |
| 22 | PF02973.18 | 0.67 | 2 | 3763 | same-strand | Sialidase, N-terminal domain |
| 23 | PF13385.8 | 0.67 | 2 | 3763 | same-strand | Concanavalin A-like lectin/glucanases superfamily |
| 24 | PF00528.24 | 1.0 | 3 | 2554 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 25 | PF01547.27 | 0.67 | 2 | 2191 | opposite-strand | Bacterial extracellular solute-binding protein |
| 26 | PF13531.8 | 0.67 | 2 | 3346.5 | both-strands | Bacterial extracellular solute-binding protein |
| 27 | PF00480.22 | 0.67 | 2 | 3379.5 | both-strands | ROK family |